Recombinant Spinacia oleracea NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Introduction to the Protein

Recombinant Spinacia oleracea NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a chloroplast-localized protein critical to photosynthetic electron transport. It belongs to the NADH dehydrogenase (NDH) complex, which facilitates electron transfer from NAD(P)H to plastoquinone in chloroplasts, coupling redox reactions to proton translocation . This process contributes to energy conservation in photosynthesis and may play roles in chloroplast respiration . The recombinant form is engineered for research, expressed in E. coli with an N-terminal His-tag for purification .

Gene and Protein Information

AttributeDetails
Gene NamendhE
UniProt IDQ9M3I9 (Spinach) , Q6ENA5 (Rice) (Note: Discrepancy observed)
Protein LengthFull-length (1–101 amino acids)
Molecular Weight~11,337 Da
SequenceMILEHVLVLSAFLFSIGIYGLVTSRNLVRALMCLELILNAVNLNFVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGPAIVSSIYRNRKSIRINQSNLLNK

Functional Insights

  • Electron Transport: Shuttles electrons via FMN and iron-sulfur (Fe-S) centers, conserving redox energy as a proton gradient .

  • Chloroplast Genome Context: Encoded in the chloroplast genome of S. oleracea, S. turkestanica, and S. tetrandra with minimal sequence divergence (3 variants between S. oleracea and S. turkestanica) .

Handling and Stability

  • Storage: -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Working Aliquots: Store at 4°C for ≤1 week .

Role in Chloroplast Metabolism

  • Photosynthetic Electron Transport: The ndhE subunit is essential for the NDH complex’s activity, which may mitigate photoinhibition under stress .

  • Chloroplast Genome Evolution: Comparative studies reveal ndhE conservation across Spinacia species, with minimal polymorphisms in the IR region of chloroplast genomes .

Potential Applications

  • Stress Response Studies: While not directly tested with the recombinant protein, S. oleracea extracts show antioxidant and anti-inflammatory properties, potentially linked to chloroplast-derived metabolites .

  • Biotechnological Tools: The recombinant protein could serve as a model for studying electron transport mechanisms or enhancing photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAFLFSIGIYGLVTSRNLVRALMCLELILNAVNLNFVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGPAIVSSIYRNRKSIRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: soe:2715589

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of ndhE within the NDH-PSI supercomplex?

The ndhE protein (NAD(P)H-quinone oxidoreductase subunit 4L) functions as an integral subunit of the chloroplast NDH complex, which transfers electrons from ferredoxin to plastoquinone while simultaneously transporting H+ across the chloroplast membrane . As part of the NDH complex, ndhE contributes to the formation of the NDH-PSI supercomplex, a structure that enhances photosystem stability under high light conditions . This subunit plays a key role in the electron transfer pathway that ultimately boosts ATP production regardless of NADPH levels, making it essential for optimizing photosynthetic efficiency .

The protein consists of 101 amino acids and is encoded by the plastid-encoded ndhE gene . Within the larger NDH complex structure, ndhE contributes to the significant structural similarity between the chloroplast NDH and mitochondrial complex I, particularly in regions involved in quinol-binding and proton translocation .

How does the NDH-PSI supercomplex form during chloroplast development?

The formation of the NDH-PSI supercomplex follows a defined developmental pathway. Research using blue native PAGE and immunoblot analysis has demonstrated that in etioplasts, the NDH complex exists as a monomer of approximately 550 kDa . During chloroplast development, this monomeric NDH complex interacts with photosystem I to form the NDH-PSI supercomplex .

The temporal dynamics of this assembly have been well-characterized. Following 24 hours of illumination during greening, a small portion of the NDH complex shifts to a higher molecular weight form in blue native gels, coinciding with the appearance of detectable PSI . After 48 hours of illumination, the NDH-PSI supercomplex becomes fully assembled . This developmental pattern suggests that while NDH can exist independently in etioplasts, its interaction with PSI may be critical for its optimal functioning in mature chloroplasts.

How does the NDH complex contribute to cyclic electron flow compared to other pathways?

The NDH complex represents one of multiple pathways for cyclic electron flow around photosystem I. Recent structural studies have revealed that the NDH complex in Spinacia oleracea closely resembles mitochondrial complex I, particularly in the quinol-binding site and the extensive internal aqueous passage for proton translocation . This similarity provides insight into the evolutionary conservation of electron transfer mechanisms.

The NDH pathway becomes especially important under stress conditions. Research has demonstrated that the NDH complex is essential for preventing over-reduction of the stroma in pgr5 (proton gradient regulation 5) mutants, which are defective in the main pathway of PSI cyclic electron transport . This finding suggests that the NDH complex serves as an alternative pathway that alleviates oxidative stress under certain environmental conditions, even in wild-type plants .

What evidence supports the interaction between NDH and PSI in vivo?

Multiple experimental approaches have confirmed the interaction between NDH and PSI in vivo:

  • Blue native PAGE analysis has revealed that antibodies against NDH subunits and PSI subunits co-localize at a high molecular mass position, indicating the formation of an NDH-PSI supercomplex .

  • Sucrose density gradient centrifugation of thylakoid membrane complexes has supported the presence of this supercomplex in intact chloroplasts .

  • Time-course studies during chloroplast development show the progressive formation of this supercomplex, transitioning from separate complexes to an integrated supercomplex over 48 hours during greening .

  • Mutant analysis using ndhl (lacking NdhL) shows accumulation of an intermediate complex with a slightly lower molecular mass than the complete NDH-PSI supercomplex, suggesting this intermediate includes some NDH subunits and PSI .

  • Further genetic evidence comes from mutants lacking NdhB, NdhD, or NdhF, which destabilize this intermediate complex, confirming the role of these subunits in the formation and stability of the NDH-PSI interaction .

What is the proton translocation mechanism in the NDH complex?

Recent structural data from cryo-electron microscopy has revealed that the NDH complex contains an extensive internal aqueous passage for proton translocation, similar to that found in mitochondrial complex I . This finding provides significant insight into how the NDH complex contributes to establishing the proton gradient across the thylakoid membrane that drives ATP synthesis.

The well-resolved catalytic plastoquinone (PQ) that occupies the PQ channel in the structure further illuminates the electron transfer pathway that couples with proton translocation . This coupling mechanism allows the NDH complex to contribute to ATP production regardless of NADPH levels, an important feature for balancing the energy requirements of photosynthesis under varying conditions .

What techniques are most effective for studying the NDH-PSI supercomplex?

Several complementary techniques have proven valuable for investigating the NDH-PSI supercomplex:

  • Blue Native PAGE (BN-PAGE): This technique has been instrumental in identifying the NDH-PSI supercomplex. The protocol typically involves solubilizing thylakoid membranes with n-dodecyl-β-D-maltoside (DM) followed by separation on a 4-12% gradient native gel . Subsequent immunoblot analysis using antibodies against NDH subunits (including NdhL) and PSI subunits (such as PsaA) can confirm the co-migration of these complexes at high molecular weight positions .

  • Cryo-Electron Microscopy: Recent advances in cryo-EM have enabled high-resolution (3.0-3.3 Å) structural determination of the NDH supercomplex, revealing intricate details of subunit interactions and functional domains . This approach requires highly purified samples and specialized equipment but provides unparalleled structural insights.

  • Sucrose Density Gradient Centrifugation: This technique provides complementary evidence for supercomplex formation in vivo by separating membrane protein complexes based on their size and density .

  • Two-dimensional Electrophoresis: Combining BN-PAGE with SDS-PAGE in a second dimension allows for identification of individual subunits within complexes . This approach has been particularly useful in monitoring the time course of supercomplex assembly during chloroplast development.

How should recombinant ndhE protein be stored and handled for optimal stability?

Based on established protocols for recombinant ndhE:

  • Storage Buffer: The optimal storage buffer is a Tris-based buffer containing 50% glycerol, specifically optimized for this protein .

  • Storage Temperature: For short-term storage, maintain working aliquots at 4°C for up to one week. For long-term storage, keep at -20°C, and for extended preservation, store at -80°C .

  • Handling Precautions: Repeated freezing and thawing should be avoided as this can lead to protein denaturation and activity loss . It is recommended to prepare small working aliquots to minimize freeze-thaw cycles.

  • Activity Preservation: To maintain functional integrity, particularly for assays measuring electron transfer activity, protein samples should be handled on ice when in use and returned to appropriate storage conditions promptly .

What expression systems are most suitable for producing functional recombinant ndhE?

While the search results don't explicitly detail expression systems for ndhE, general considerations for membrane protein expression can be applied:

  • E. coli-based Systems: For basic structural studies, E. coli expression systems can be used, though membrane proteins often present challenges regarding proper folding and solubility.

  • Plant-based Expression: For functional studies, plant-based expression systems may provide the appropriate cellular environment for correct folding and post-translational modifications.

  • Cell-free Systems: These can be advantageous for membrane proteins like ndhE, allowing direct incorporation into liposomes or nanodiscs.

Regardless of the expression system chosen, fusion tags may be necessary to enhance solubility and facilitate purification, though the tag type should be determined during the production process to optimize for the specific properties of ndhE .

How can researchers measure electron transfer activity of the NDH complex containing ndhE?

Several approaches can be used to assess the electron transfer activity of NDH complex:

  • Spectroscopic Methods: Changes in absorption spectra of electron carriers (NAD(P)H, plastoquinone) can be monitored to assess electron transfer rates.

  • Chlorophyll Fluorescence Analysis: This non-invasive technique can measure cyclic electron flow around PSI in vivo, providing indirect evidence of NDH activity.

  • Polarographic Measurements: Oxygen electrode-based assays can measure changes in oxygen consumption or evolution related to NDH activity.

  • In vitro Reconstitution Assays: Purified components including recombinant ndhE can be reconstituted into liposomes to measure electron transfer from NAD(P)H to plastoquinone analogues.

For these assays, it's critical to maintain the structural integrity of the protein through appropriate buffer conditions and temperature control as specified in storage recommendations .

What mutant analysis approaches have been most informative for understanding ndhE function?

Genetic approaches have provided significant insights into ndhE function within the context of the NDH complex:

  • Knockout/Knockdown Studies: Analysis of mutants lacking various NDH subunits (including NdhL, NdhB, NdhD, and NdhF) has revealed their roles in the assembly and stability of the NDH-PSI supercomplex . Similar approaches with ndhE would likely be informative.

  • Site-directed Mutagenesis: Although not explicitly mentioned in the search results for ndhE, targeted mutation of conserved residues can help identify functionally important amino acids involved in electron transfer or protein-protein interactions.

  • Complementation Studies: Reintroducing wild-type or modified ndhE into mutant backgrounds can confirm the functional significance of specific protein domains.

  • Comparative Analysis: Examining differences in NDH complex assembly and function across species with variant ndhE sequences can provide evolutionary insights into structure-function relationships.

What are the remaining questions about ndhE structure and function?

Several important questions remain unanswered regarding ndhE:

  • Precise Role in Electron Transfer: The specific contribution of ndhE to the electron transfer pathway within the NDH complex needs further elucidation.

  • Interaction Domains: The exact amino acid sequences or structural motifs that mediate interactions between ndhE and other NDH subunits remain to be fully characterized.

  • Regulation Mechanisms: How environmental factors and developmental signals regulate ndhE expression and assembly into the NDH complex requires additional investigation.

  • Post-translational Modifications: Potential modifications of ndhE and their functional significance have not been thoroughly explored.

  • Species-specific Variations: Comparative analysis of ndhE across different plant species could reveal evolutionary adaptations to diverse environmental conditions.

How might advances in structural biology further illuminate ndhE function?

Recent developments in structural biology techniques hold promise for deeper understanding of ndhE:

  • Higher-Resolution Structures: While the current cryo-EM structure of the NDH supercomplex provides valuable insights at 3.0-3.3 Å resolution , even higher resolution structures could reveal additional details of ndhE's integration within the complex.

  • Time-resolved Structural Analysis: Capturing different conformational states during the electron transfer process could illuminate the dynamic aspects of ndhE function.

  • Integrative Structural Biology: Combining cryo-EM with other techniques such as mass spectrometry, EPR spectroscopy, and computational modeling could provide a more comprehensive view of ndhE's structural context.

  • In situ Structural Studies: Emerging techniques for studying protein structures within their native cellular environment could reveal physiologically relevant interactions and conformations.

The remarkable structural similarity between the NDH complex and mitochondrial complex I revealed by recent studies provides a foundation for further exploration of the evolutionary and functional relationships between these important energy-transducing complexes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.