Recombinant Spinacia oleracea NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

What is NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) in spinach?

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) is a protein component of the NAD(P)H dehydrogenase complex located in the thylakoid membrane of spinach chloroplasts. This protein is encoded by the ndhG gene and functions as part of the chloroplast electron transport chain. The protein has an EC classification of 1.6.5.- and is also known as NAD(P)H dehydrogenase subunit 6 or NADH-plastoquinone oxidoreductase subunit 6 . The full amino acid sequence consists of 176 amino acids with distinct transmembrane domains that contribute to its function within the chloroplast membrane system.

What is the amino acid sequence of spinach ndhG protein?

The full amino acid sequence of spinach ndhG protein consists of 176 amino acids as follows:

MDLPGPIHDFLLVFLGSGLILGALGVVLFTNPIFSAFSLGLVLVCISLFYILANSHFVAS AQLLIYVGAINVLIIFSVMFMSGPEYDKKFQLWTVGDGVTSLVCISLFVSLISTILNTSW YGIIWTTKSNQILEQDLINASQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

This sequence includes multiple transmembrane domains, which is consistent with its function as a membrane-bound protein in the chloroplast thylakoid membrane.

How does ndhG contribute to photosynthesis in spinach?

The ndhG protein, as part of the NAD(P)H dehydrogenase complex in chloroplasts, participates in cyclic electron flow around photosystem I. This process is particularly important for generating additional ATP without producing NADPH, helping balance the ATP:NADPH ratio required for carbon fixation. Under certain stress conditions, such as nitrogen limitation, the activity of this complex may be upregulated to maintain energy balance in the chloroplast. Research on spinach nitrogen use efficiency has shown that photosynthetic apparatus components can be affected by nitrogen availability, suggesting that proteins like ndhG may play important roles in adapting to varying nutrient conditions .

What are the recommended storage conditions for recombinant ndhG protein?

For optimal stability and activity retention, recombinant Spinacia oleracea ndhG protein should be stored in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein. Short-term storage can be at -20°C, while for extended storage, it is recommended to keep the protein at -20°C or -80°C. To avoid protein degradation from freeze-thaw cycles, it is not recommended to repeatedly freeze and thaw the protein. Working aliquots can be stored at 4°C for up to one week . These storage recommendations are critical for maintaining protein structure and function for experimental use.

What methods are effective for studying ndhG protein expression in response to environmental stressors?

To study ndhG protein expression in response to environmental stressors such as nitrogen limitation, researchers can employ several complementary approaches:

• RNA expression analysis: Using real-time PCR techniques similar to those employed in stress response studies of spinach . This involves extracting RNA from plant tissues under different stress conditions, synthesizing cDNA, and quantifying transcript levels using specific primers for the ndhG gene.

• Protein quantification: Western blotting with antibodies specific to ndhG or proteomics approaches to measure protein levels.

• Enzyme activity assays: Measuring NAD(P)H dehydrogenase activity in isolated thylakoid membranes.

• Experimental design: For nitrogen stress experiments, plants can be grown under controlled conditions with varying nitrogen concentrations, similar to the hydroponics system used in nitrogen use efficiency studies on spinach . Parameters such as shoot fresh weight (SFW), shoot dry weight (SDW), and leaf area (LA) can be measured alongside ndhG expression to correlate protein function with physiological responses.

How can recombinant ndhG protein be used in enzymatic activity assays?

For enzymatic activity assays using recombinant ndhG protein:

• Reconstitution system: Since ndhG is one subunit of a larger complex, it may need to be reconstituted with other complex components for full activity measurement.

• Substrate preparation: Prepare NAD(P)H and appropriate quinone substrates in buffer conditions that mimic the chloroplast environment.

• Activity measurement: Monitor the oxidation of NAD(P)H spectrophotometrically at 340 nm, as the absorbance decreases when NAD(P)H is oxidized to NAD(P)+.

• Controls: Include appropriate negative controls (heat-inactivated enzyme) and positive controls (known active preparations of NAD(P)H dehydrogenase).

• Data analysis: Calculate enzyme kinetics parameters (Km, Vmax) to characterize the recombinant protein's activity compared to native preparations.

How does ndhG function differ under varying nitrogen conditions in spinach?

Research on nitrogen use efficiency in spinach has demonstrated that photosynthetic apparatus components can be significantly affected by nitrogen availability . Under nitrogen-limited conditions, several physiological responses have been observed:

• Plants show variation in shoot dry weight (SDW), root dry weight (RDW), and total dry weight (TDW), which correlate highly with nitrogen use efficiency (NUE).

• Different spinach cultivars exhibit varying tolerance to nitrogen limitations, suggesting genetic variation in the expression or function of proteins involved in nitrogen response pathways.

• The correlation between specific leaf area (SLA) and NUE becomes evident at the end of the growth period under nitrogen-limited conditions .

What techniques are most effective for studying protein-protein interactions involving ndhG?

To study protein-protein interactions involving ndhG:

• Co-immunoprecipitation (Co-IP): Using antibodies against ndhG to pull down the protein along with its interacting partners, followed by mass spectrometry identification.

• Yeast two-hybrid (Y2H) assays: By expressing ndhG as a bait protein to screen for potential interacting partners.

• Bimolecular Fluorescence Complementation (BiFC): To visualize protein interactions in planta by fusing fragments of fluorescent proteins to ndhG and potential interacting proteins.

• Cross-linking studies: Using chemical cross-linkers to stabilize transient interactions before isolation and identification.

• Blue Native PAGE: To isolate intact protein complexes containing ndhG from thylakoid membranes for subsequent analysis of complex composition.

These techniques can reveal how ndhG interacts with other subunits of the NAD(P)H dehydrogenase complex and potentially with other photosynthetic or metabolic proteins.

How can structural analysis of ndhG contribute to understanding its function?

Structural analysis of ndhG provides critical insights into its function:

• Transmembrane domain analysis: The amino acid sequence indicates several hydrophobic regions consistent with transmembrane domains (e.g., "FLGSGLILGALGVVLFTN" and other hydrophobic segments in the sequence) , suggesting how the protein is oriented in the thylakoid membrane.

• Structural predictions: Computational modeling can predict secondary and tertiary structures based on the amino acid sequence, revealing functional domains.

• Site-directed mutagenesis: Based on structural predictions, specific amino acids can be mutated to test their importance for protein function. Key residues for investigation might include those in the conserved regions of the sequence.

• Comparative structural analysis: Comparing the structure of spinach ndhG with homologous proteins from other plants can identify conserved structural features important for function.

Understanding the structure-function relationship of ndhG can help explain how environmental factors like nitrogen availability affect the protein's activity and its role in plant adaptation to stress.

What expression systems are most suitable for producing functional recombinant ndhG protein?

The choice of expression system for recombinant ndhG depends on research objectives:

• Prokaryotic systems (E. coli):

  • Advantages: High yield, fast growth, economical

  • Challenges: May lack proper folding for membrane proteins, absence of post-translational modifications

  • Modifications needed: Use of specialized strains (e.g., C41/C43) designed for membrane protein expression; fusion with solubility tags

• Eukaryotic systems:

  • Yeast: Provides membrane structures for proper folding while maintaining relatively high yields

  • Insect cells: Better for complex membrane proteins requiring specific post-translational modifications

  • Plant expression systems: Most natural environment for proper folding and assembly but typically lower yields

• Cell-free expression systems:

  • Advantages: Rapid production, ability to incorporate modified amino acids

  • Suitable for: Initial functional studies requiring small amounts of protein

When expressing membrane proteins like ndhG, it's crucial to include proper detergents or lipid environments during purification to maintain native-like structure and function.

What purification strategies are most effective for recombinant ndhG?

Effective purification strategies for recombinant ndhG include:

• Affinity chromatography:

  • His-tag purification: Most common approach, using a 6-8 histidine tag attached to either N- or C-terminus

  • Other tags: GST, MBP, or FLAG tags can be used depending on experimental needs

• Membrane protein-specific considerations:

  • Detergent selection: Critical for maintaining protein structure; commonly used detergents include DDM, LDAO, or CHAPS

  • Detergent exchange: During purification to optimize stability and activity

• Secondary purification steps:

  • Size exclusion chromatography: To separate properly folded protein from aggregates

  • Ion exchange chromatography: For further purification based on charge properties

• Quality control:

  • Circular dichroism: To verify secondary structure

  • Functional assays: To confirm that the purified protein retains activity

The final purification protocol should be optimized based on the specific research requirements, balancing protein yield, purity, and retention of functional properties.

How can ndhG function be studied in the context of oxidative stress response?

Studying ndhG in oxidative stress contexts requires:

• Stress induction protocols:

  • Artificial oxidative stress: Using methyl viologen (paraquat) or hydrogen peroxide treatments

  • Natural stress conditions: High light, drought, or temperature extremes

• Measurement parameters:

  • Gene expression: qRT-PCR analysis of ndhG transcript levels under stress conditions

  • Protein levels: Western blot analysis with specific antibodies

  • ROS detection: Using fluorescent probes to correlate ROS levels with ndhG function

• Functional assays:

  • Chlorophyll fluorescence: To assess photosynthetic electron transport efficiency

  • NAD(P)H oxidation rates: In isolated thylakoids from stressed plants

• Genetic approaches:

  • RNA interference or CRISPR to modulate ndhG expression levels

  • Overexpression studies to evaluate protective effects

Research has shown that spinach extracts contain compounds with significant antioxidant and anti-inflammatory properties , suggesting that proteins involved in electron transport, like ndhG, may play important roles in oxidative stress management through their influence on cellular redox state.

What is the relationship between ndhG function and nitrogen use efficiency in spinach?

The relationship between ndhG function and nitrogen use efficiency can be explored through:

• Comparative analysis across cultivars:
  Research has demonstrated significant variation in nitrogen use efficiency among spinach cultivars . Different cultivars show varying responses to nitrogen limitation, with some exhibiting better tolerance to low nitrogen conditions than others.

• Correlation with physiological parameters:
  The following parameters highly correlate with nitrogen use efficiency and could be linked to ndhG function:

  • Shoot dry weight (SDW)

  • Root dry weight (RDW)

  • Total dry weight (TDW)

  • Leaf area (LA)

  • Root length (RL)

  • Root surface area (RSA)

• Temporal considerations:
  Some parameters like dry matter percentage (DM%) and specific leaf area (SLA) become good indicators of NUE only at the end of the growth period , suggesting that the role of proteins like ndhG in nitrogen adaptation may change throughout plant development.

• Experimental approach:
  Studies can be designed using hydroponic systems with controlled nitrogen levels to evaluate the correlation between ndhG expression levels and the plant's nitrogen use efficiency metrics.

Understanding this relationship could potentially identify ndhG as a target for breeding programs aimed at improving spinach production under limited nitrogen conditions.