Recombinant Spinacia oleracea Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Spinacia oleracea Photosystem I Assembly Protein Ycf4 (ycf4)

Recombinant Spinacia oleracea Photosystem I (PSI) assembly protein Ycf4 (ycf4) is a crucial component in the biogenesis of Photosystem I, a large protein-pigment complex embedded in the thylakoid membranes of chloroplasts . PSI is essential for catalyzing the transfer of electrons across the thylakoid membrane, which is a critical step in photosynthesis . The Ycf4 protein is encoded by the chloroplast genome and acts as an auxiliary factor in the assembly of PSI .

Function of Ycf4 in Photosystem I Assembly

Ycf4 plays a vital role in the assembly and stability of the PSI complex . Specifically, Ycf4 facilitates the integration of peripheral PSI subunits and light-harvesting complexes (LHCIs) into the PSI reaction center subcomplex . Research indicates that Ycf4 forms modules that mediate PSI assembly, working in conjunction with other proteins such as Ycf3 and Y3IP1 .

Key Research Findings

  • Ycf4 as an Assembly Factor: Ycf4 is identified as a non-essential assembly factor for PSI in higher plants such as Nicotiana tabacum . Knockout studies in tobacco have demonstrated that while PSI accumulation is significantly reduced in the absence of Ycf4, the plants can still grow photoautotrophically, suggesting that Ycf4 is more critical in some organisms (e.g., Chlamydomonas reinhardtii) than others .

  • Interaction with Other Proteins: Ycf4 interacts with other PSI subunits and assembly factors. For instance, it forms a complex with COP2 (an opsin-related protein) and PSI subunits such as PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . These interactions are crucial for the proper assembly of PSI .

  • Structural Studies: Biochemical and structural studies have revealed that Ycf4 is part of a large complex (>1500 kD) that contains newly synthesized PSI polypeptides . Electron microscopy has visualized these complexes, providing insights into their structure and organization .

Ycf4 and Photosystem I Biogenesis

The biogenesis of PSI is a complex process that requires the coordinated assembly of nucleus-encoded and chloroplast-encoded protein subunits, as well as the insertion of numerous cofactors . Ycf4 functions post-translationally in the PSI assembly process . It is involved in the early stages of PSI assembly, mediating interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex .

Importance of Ycf4 in Photosynthesis

The Ycf4 protein domain, located on the thylakoid membrane, is essential for efficient photosynthesis . Without Ycf4, the assembly of PSI components is impaired, leading to reduced photosynthetic efficiency .

Comparative Studies and Evolutionary Aspects

Molecular data suggest that PSI likely evolved from the photosystems of green sulfur bacteria . Although the photosystems of green sulfur bacteria and those of cyanobacteria, algae, and higher plants are not identical, they share analogous functions and similar structures . The Ycf4 protein is conserved across various photosynthetic organisms, highlighting its importance in PSI assembly .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
ycf4
Target Protein Sequence
MNWRSERIWVEFITGSRKISNFCWAFILFLGSSGFLLVGISSYLGKNFISLFPPQQILFF PQGLVMSFYGIAGLFISAYLWCAISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFFRY LIKDIQSIRIELKEGIYTRRVLYLEIRGQGAIPLTRTDENLTPREMEQKAAELAYFLRVP IEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Database Links

KEGG: soe:2715691

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ycf4 in photosynthetic organisms?

Ycf4 is a thylakoid membrane protein that plays an essential role in the assembly of Photosystem I (PSI). It functions as a scaffold for the assembly of PSI subunits, stabilizing intermediate subcomplexes during the assembly process. Specifically, Ycf4 stabilizes an intermediate subcomplex consisting of the PsaAB heterodimer and the three stromal subunits PsaCDE, and facilitates the addition of the PsaF subunit to this subcomplex . While Ycf4 is absolutely essential for PSI assembly in Chlamydomonas reinhardtii, cyanobacterial mutants deficient in Ycf4 can still assemble PSI complexes, albeit at reduced levels . This suggests evolutionary differences in the dependency on Ycf4 across photosynthetic organisms.

How is Ycf4 organized structurally in the thylakoid membrane?

Ycf4 is a membrane-anchored protein located in the thylakoid membrane. In most photosynthetic organisms, Ycf4 is approximately 184-185 amino acids in length, though notable exceptions exist in some legumes like soybean and Lotus japonicus where it has expanded to about 200 residues . Electron microscopy of purified Ycf4-containing complexes reveals large structures measuring approximately 285 × 185 Å, which may represent several large oligomeric states . These complexes are stable and can be isolated through multi-step purification processes, indicating strong associations between component proteins.

What are the genetic organization and expression patterns of the ycf4 gene?

In Chlamydomonas reinhardtii, the ycf4 gene is part of a polycistronic transcriptional unit (rps9-ycf4-ycf3-rps18) on the chloroplast genome . This unit is co-transcribed into RNAs of 8.0 kb and 3.0 kb, corresponding to the entire unit and to rps9-ycf4-ycf3, respectively . The organization of this gene cluster appears to be conserved across various photosynthetic organisms, suggesting functional importance. Expression analyses have shown that ycf4 transcription occurs in coordination with other PSI-related genes, though Ycf4 protein accumulation is not strictly dependent on the presence of PSI complexes .

What are effective approaches for expressing and purifying recombinant Ycf4 protein?

Successful expression and purification of recombinant Ycf4 can be achieved through several methods:

  • Tandem Affinity Purification (TAP) tagging: This method has been successfully employed to purify Ycf4-containing complexes from C. reinhardtii. The approach involves:

    • Generating a C-terminal TAP-tagged Ycf4 construct consisting of calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site

    • Two-step affinity column chromatography: first with IgG agarose followed by calmodulin resin

    • Extended adsorption time (overnight at 4°C) to improve binding efficiency

  • Chloroplast transformation: For expression in chloroplasts, researchers have generated transformants in which Ycf4 is fused with an HA tag at its N-terminus (N-HA-Ycf4) .

When purifying the Ycf4 complex, the following buffer conditions have proven effective:

  • Solubilization of thylakoid membranes with n-dodecyl-β-D-maltoside (DDM)

  • TEV protease digestion at 18°C for tag removal

  • Addition of calcium ions for binding to calmodulin resin

  • Elution with EGTA

What technical approaches are most effective for analyzing Ycf4-PSI interactions?

Several complementary techniques have been employed to study Ycf4-PSI interactions:

  • Mass Spectrometry Analysis:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for protein identification

    • Label-free protein quantification in cell extracts and isolated proteins

    • Structural proteomics by crosslinking (XL-MS)

  • Electron Microscopy:

    • Single particle analysis for structural characterization

    • Transmission electron microscopy of purified Ycf4-containing complexes

  • Biochemical Approaches:

    • Sucrose gradient ultracentrifugation followed by ion exchange chromatography

    • Pulse-chase protein labeling to track newly synthesized PSI polypeptides

    • Immunoblotting with antibodies against specific PSI subunits

  • Genetic Methods:

    • Biolistic transformation for gene disruption

    • RNA interference to reduce protein levels

    • Generation of knockout mutants

How can researchers effectively measure PSI assembly in the presence and absence of functional Ycf4?

To measure PSI assembly efficiency and the impact of Ycf4, researchers can employ these methodological approaches:

  • Photoautotrophic Growth Assessment:

    • Compare growth of wild-type and ycf4-deficient strains on minimal media under different light intensities

    • Quantify growth rates under mixotrophic conditions

  • Fluorescence Analysis:

    • Measure fluorescence transients of dark-adapted cells

    • In wild-type cells, fluorescence declines after reaching maximum

    • In ycf4-deficient cells, a continuous fluorescence rise is observed

  • Biochemical Quantification of PSI:

    • Western blot analysis to quantify PSI subunit accumulation

    • Blue native gel electrophoresis to assess intact PSI complex assembly

  • Electron Transport Measurements:

    • P700 oxidation kinetics

    • PSI-mediated electron transport rates

  • Pulse-Chase Experiments:

    • Track the fate of newly synthesized PSI subunits

    • Determine if they accumulate in subcomplexes or are rapidly degraded

How does Ycf4 structure and function vary across photosynthetic organisms?

The evolutionary conservation and divergence of Ycf4 across photosynthetic organisms presents fascinating research questions:

  • Sequence Conservation:

    • Deduced amino acid sequences of Ycf4 display 41-52% sequence identity between green algae, land plants, and cyanobacteria

    • Ycf3, another PSI assembly factor, shows higher conservation (64-78% identity)

  • Functional Conservation:

    • Essential for PSI assembly in Chlamydomonas reinhardtii

    • Dispensable but important in cyanobacteria (PSI assembly reduced but not eliminated)

    • Required for stable accumulation of PSI complex in both systems

  • Structural Variations:

    • Standard length of 184-185 amino acids in most organisms

    • Expanded to ~200 residues in some legumes (soybean, Lotus japonicus)

    • Completely lost in some Lathyrus species

  • Mutation Rates:

    • In some legume lineages, ycf4 is located in a mutation hotspot with dramatically accelerated evolution

    • Exhibit high levels of synonymous substitution between related species

What evidence exists for gene transfer or loss of ycf4 in certain plant lineages?

The evolutionary trajectory of ycf4 in legumes provides an intriguing case study of gene dynamics:

What is the composition of the Ycf4-containing complex in chloroplasts?

The Ycf4-containing complex has been characterized as a large (>1500 kD) multiprotein assembly. Its composition includes:

  • Core Components:

    • Ycf4 protein

    • Opsin-related protein COP2

  • Associated PSI Subunits:

    • PsaA and PsaB (reaction center subunits)

    • PsaC, PsaD, and PsaE (stromal subunits)

    • PsaF (peripheral subunit)

These components were identified through mass spectrometry (LC-MS/MS) and immunoblotting analyses . Importantly, almost all Ycf4 and COP2 in wild-type cells copurify by sucrose gradient ultracentrifugation and subsequent ion exchange column chromatography, indicating their intimate and exclusive association .

What is the sequential mechanism of PSI assembly mediated by Ycf4?

Research has revealed that PSI assembly involves a coordinated process mediated by distinct protein modules:

  • First Module: Ycf3-Y3IP1

    • Consists of the tetratricopeptide repeat protein Ycf3 and its interacting partner, Y3IP1

    • Primarily facilitates the assembly of reaction center subunits (PsaA and PsaB)

  • Second Module: Ycf4 Complex

    • Consists of oligomeric Ycf4

    • Facilitates the integration of peripheral PSI subunits and LHCIs into the PSI reaction center subcomplex

  • Sequential Assembly Steps:

    • Initial assembly of PsaA/PsaB heterodimer (facilitated by Ycf3-Y3IP1)

    • Stabilization of intermediate subcomplex containing PsaAB heterodimer and stromal subunits PsaCDE (by Ycf4)

    • Addition of PsaF subunit to this subcomplex (mediated by Ycf4)

    • Integration of peripheral subunits and light-harvesting complexes (facilitated by Ycf4)

Pulse-chase protein labeling experiments have revealed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, supporting its role as a scaffold for assembly .

How do mutations in Ycf4 affect photosynthetic performance?

Studies on ycf4 mutants have revealed significant impacts on photosynthetic performance:

  • Growth Phenotypes:

    • Transformants lacking ycf4 are unable to grow photoautotrophically

    • Growth is severely impaired even under mixotrophic conditions at light intensity of 80 μE/m²/s

  • Fluorescence Characteristics:

    • ycf4-deficient transformants show fluorescence patterns characteristic of cells deficient in PSI

    • Rather than declining after reaching maximum (as in wild-type), a continuous fluorescence rise is observed

  • PSI Complex Accumulation:

    • Western blot analysis shows that the PSI complex does not accumulate stably in thylakoid membranes of ycf4-deficient transformants

    • Transcripts of psaA, psaB, and psaC accumulate normally, indicating post-transcriptional effects

  • Impact of Partial Reduction:

    • Reduction of Ycf4 to 75% of wild-type levels does not affect PSI assembly and stability

    • TAP-tagged strains with reduced Ycf4 display normal PSI activity and grow photoautotrophically like wild-type under both medium (50 μE/m²/s) and high light (1000 μE/m²/s) conditions

What structural features of Ycf4 are critical for its PSI assembly function?

Advanced structural biology approaches have begun to elucidate critical features of Ycf4:

  • Electron Microscopy Findings:

    • The largest structures in purified Ycf4 preparations measure 285 × 185 Å

    • These particles may represent several large oligomeric states

  • Functional Domains:

    • C-terminal modifications (such as TAP-tagging) do not significantly affect function

    • Interaction domains with COP2 and PSI subunits remain to be fully characterized

  • Methodology for Structural Determination:

    • Cryo-EM with the following parameters has been successful for related photosystem studies:

      • 300 kV Titan Krios G3 microscope

      • Gatan BioQuantum energy filter and K3 Summit direct electron detector

      • Magnification of ×105,000

      • Pixel size of 0.84-0.85 Å

      • Total dose of 45-51 e Å⁻²

      • Defocus range from -0.5 μm to -1.9 μm

How do auxiliary factors interact with Ycf4 to facilitate PSI assembly?

Research has identified several auxiliary factors that work in concert with Ycf4:

  • COP2 Interaction:

    • The opsin-related protein COP2 consistently copurifies with Ycf4

    • RNAi-mediated reduction of COP2 to 10% of wild-type levels increases salt sensitivity of the Ycf4 complex but does not affect PSI accumulation

    • This suggests COP2 plays a role in stabilizing the Ycf4 complex but is not essential for PSI assembly

  • Ycf3 Coordination:

    • Ycf3 and Ycf4 form distinct modules that mediate different aspects of PSI assembly

    • Both are required for stable accumulation of the PSI complex

    • Neither is stably associated with the mature PSI complex

  • Research Methodology for Interaction Studies:

    • Crosslinking mass spectrometry (XL-MS) has proven valuable for identifying protein-protein interactions

    • Co-immunoprecipitation with tagged proteins

    • Two-hybrid analyses for in vivo interaction verification

What is the relationship between the PSI assembly intermediates observed in the Ycf4 complex and the final PSI structure?

The relationship between assembly intermediates and mature PSI structure presents intriguing research questions:

  • Structural Comparison Data:

    ParameterMature PSIPre-PSI-1 (Assembly Intermediate)
    Magnification105,000105,000
    Voltage (kV)300300
    Electron exposure (e⁻ Å⁻²)4551.35
    Defocus range (μm)-0.5 to -1.9-0.5 to -1.9
    Pixel size (Å)0.850.84
    Initial particle images (n)24,9303,324
    Final particle images (n)96,997169,213
    Map resolution (Å)2.22.11
    Map sharpening B factor (Ų)-17.41-21.56
  • Key Research Findings:

    • Pulse-chase protein labeling reveals that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized

    • These polypeptides are assembled into a pigment-containing subcomplex

    • This suggests a stepwise assembly process where Ycf4 acts as a scaffold

  • Methodological Approaches:

    • Time-resolved structural studies combining rapid isolation techniques with cryo-EM

    • In vitro reconstitution experiments with purified components

    • Site-directed mutagenesis to probe specific interaction sites

What are the current technical limitations in studying Ycf4 function and structure?

Researchers face several technical challenges when investigating Ycf4:

  • Membrane Protein Challenges:

    • Maintaining native structure during purification

    • Obtaining sufficient quantities of functional protein

    • Preserving protein-protein interactions during isolation

  • Transient Interactions:

    • The dynamic nature of assembly intermediates makes them difficult to capture

    • Timing of sample collection is critical for observing specific assembly states

  • Evolutionary Variations:

    • Significant differences in ycf4 sequence and function across species complicate comparative analyses

    • Species-specific adaptations may limit the generalizability of findings

How might emerging technologies advance our understanding of Ycf4-mediated PSI assembly?

Several emerging technologies hold promise for advancing Ycf4 research:

  • High-Resolution Cryo-EM:

    • Recent advances in cryo-EM now permit visualization of membrane protein complexes at near-atomic resolution

    • Time-resolved cryo-EM may capture assembly intermediates

  • Advanced Mass Spectrometry:

    • Cross-linking mass spectrometry (XL-MS) to map protein-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic structural changes

    • Label-free quantitative proteomics to track assembly factor dynamics

  • Single-Molecule Techniques:

    • FRET-based approaches to monitor protein-protein interactions in real-time

    • Super-resolution microscopy to visualize assembly processes in vivo

  • Computational Approaches:

    • Molecular dynamics simulations to model Ycf4-PSI interactions

    • Machine learning algorithms to predict critical structural features and binding sites

What are the broader implications of understanding Ycf4 function for photosynthesis research?

Understanding Ycf4 function has significant implications for multiple areas of photosynthesis research:

  • Synthetic Biology Applications:

    • Engineering more efficient photosynthetic systems

    • Design of minimal photosynthetic units for biotechnological applications

  • Evolutionary Insights:

    • Understanding the adaptation of photosynthetic machinery across diverse lineages

    • Elucidating the mechanisms of gene loss and potential transfer to the nuclear genome

  • Agricultural Implications:

    • Potential targets for improving photosynthetic efficiency in crops

    • Understanding stress responses in photosynthetic machinery

  • Fundamental Assembly Mechanisms:

    • Model system for studying membrane protein complex assembly

    • Insights into coordination between chloroplast and nuclear gene expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.