Recombinant Spinacia oleracea Photosystem I reaction center subunit V, chloroplastic (PSAG)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Spinacia oleracea Photosystem I reaction center subunit V, chloroplastic (PSAG) refers to a synthetic version of the native PSAG protein, expressed in E. coli for research or biotechnological applications. This 9 kDa transmembrane protein is a minor subunit of Photosystem I (PSI), a pigment-protein complex central to light-driven electron transfer in chloroplasts .

PropertyDetails
Uniprot IDP12357
Alternative NamesPSI-G, Photosystem I 9 kDa protein
Expression HostE. coli (in vitro)
TagN-terminal 10xHis-tag
Sequence RegionResidues 70–167 (ELSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF)
Storage Conditions-20°C (long-term), -80°C (extended storage); avoid repeated freeze-thaw cycles

Biochemical and Biophysical Data

  • Expression and Purification: Recombinant PSAG is produced in E. coli and purified via affinity chromatography (His-tag) .

  • Stability: Lyophilized PSAG maintains activity for 12 months at -20°C/-80°C .

  • Functional Insights: No direct studies link PSAG to specific electron transfer or structural roles. Its small size and peripheral location in PSI suggest a potential regulatory or stabilizing function .

  • Biotechnology: Recombinant PSAG may serve as a tool to study PSI subunit dynamics or engineer photosynthetic efficiency in crops.

  • Structural Biology: Further cryo-EM studies are needed to resolve PSAG’s position and interactions within PSI.

  • Evolutionary Insights: Genetic studies of Spinacia oleracea (e.g., SNP diversity in PSAG-encoding regions) could reveal adaptive pressures on PSI subunits .

References

  1. Product Specifications: MyBioSource (MBS7059526) and Cusabio (CSB-CF320962FKI) .

  2. Structural Studies: Cryo-EM analyses of plant and algal PSI .

  3. Genetic Diversity: Spinacia population studies highlight genomic regions under selection .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate this requirement during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which serves as a reference for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize the development of the specified tag.
Synonyms
PSAG; Photosystem I reaction center subunit V, chloroplastic; PSI-G; Photosystem I 9 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
70-167
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Names
PSAG
Target Protein Sequence
ELSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQVPEQNGMSHFEAGDTRAKEYVSLLKS NDPVGFNIVDVLAWGSIGHIVAYYILATASNGYDPSFF
Uniprot No.

Target Background

Function
The target background function is currently unknown.
Protein Families
PsaG/PsaK family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genetic origin of Spinacia oleracea PSAG and how does it relate to wild relatives?

PSAG in cultivated spinach (Spinacia oleracea L.) shares genetic lineage with its wild ancestors. Spinach is genetically closer to S. turkestanica than to S. tetrandra, as demonstrated by higher amplification success and variation levels in genetic studies . This evolutionary relationship is important when considering the conservation of photosystem components across Spinacia species. When studying recombinant PSAG, researchers should consider the ancestral genetic diversity from Eastern and Southern Asian landraces that show strong genetic resemblance to S. turkestanica, particularly those from Afghanistan and Pakistan . This genetic context provides important baseline information for understanding structural and functional conservation of photosystem components.

What are the standard methods for isolating native PSAG from Spinacia oleracea?

Isolation of native PSAG from spinach typically employs sequential chromatographic techniques. Based on established protocols for spinach protein isolation, researchers should initially extract chloroplastic proteins using buffer systems containing MOPS-NaOH (pH 7.5), MgCl₂, DTT, EDTA, PMSF, and mild detergents like Triton X-100 . For purification, a multistep approach using ion exchange chromatography is recommended. DEAE-Sepharose, Blue Sepharose, and Resource Q columns can be used sequentially to achieve progressive purification . Native gel electrophoresis (non-denaturing 10% polyacrylamide) can then separate protein complexes while maintaining structural integrity. For highest purity, electroelution of the target band followed by dialysis is effective for obtaining research-grade PSAG preparations .

How does spinach leaf extraction methodology impact PSAG integrity?

The extraction method significantly influences PSAG integrity and functionality. Optimal extraction from spinach leaves requires careful buffer selection. A recommended approach involves using a 1:2 ratio of leaf material to extraction buffer (50 mM MOPS-NaOH, pH 7.5, 10 mM MgCl₂, 5 mM DTT, 1 mM EDTA, 0.5 mM PMSF, and 0.1% Triton X-100) . This buffer composition maintains protein stability while effectively solubilizing membrane-associated components. The extract should be centrifuged at 14,000×g and filtered through Miracloth to remove debris while preserving protein complexes . These steps are crucial as inadequate extraction can lead to PSAG degradation or incomplete solubilization, compromising downstream applications like activity assays or structural studies.

What regulatory proteins affect PSAG assembly into functional photosystem complexes?

Cyclophilins play a critical role in regulating photosystem assembly, which directly impacts PSAG incorporation. Research indicates that specific cyclophilins like anaCyp40 regulate photosystem assembly and function . When investigating PSAG assembly dynamics, researchers should consider these regulatory proteins as they facilitate proper protein folding and complex formation. Experimental designs should include analysis of potential cyclophilin interactions with PSAG, particularly when studying recombinant expression systems. The table below shows proteins that may interact with photosystem components, which could include regulatory effects on PSAG:

CategoryGene IDNamep-valueExpD.MPaa% P
BAITAlr5059BAIT1 × 10⁻³340--
RibosomeAll4199S51 × 10⁻³3101743.4
All4202S81 × 10⁻³3111333.0
All4203L51 × 10⁻³3121824.4
All4210L221 × 10⁻³351195.0
All4213L231 × 10⁻³3101049.6
All4205L142 × 10⁻³2101224.1
All4214L42 × 10⁻³2112103.3

Such interaction studies can provide crucial insights into the assembly kinetics and stability of photosystem complexes containing PSAG .

How can researchers distinguish between direct PSAG effects and indirect photosystem alterations?

Distinguishing direct PSAG effects from broader photosystem alterations requires carefully designed control experiments. A recommended approach involves comparative studies using recombinant PSAG variants with specific mutations. When investigating functional differences, researchers should isolate thylakoid membrane complexes using differential centrifugation followed by analysis of specific electron transport parameters. Selective inhibitors of other photosystem components can help isolate PSAG-specific functions. Analysis of fluorescence emission spectra before and after selective photoinhibition provides evidence of direct PSAG involvement in specific photosystem functions. Advanced techniques like blue native PAGE coupled with second-dimension SDS-PAGE can reveal PSAG interactions within the larger complex, helping to distinguish direct effects from downstream consequences of structural perturbations.

What techniques are most effective for studying PSAG post-translational modifications in Spinacia oleracea?

Post-translational modifications (PTMs) of PSAG can be effectively studied using a combination of mass spectrometry and targeted biochemical assays. LC-TOF/MS analysis using an RP-C18 column with carefully optimized mobile phase gradients (0.1% formic acid and ACN, with 30–90% ACN in 30 min) is effective for identifying modified peptides . For optimal results, information dependent acquisition (IDA) mode should be used with MS scan ranges of 100–1000 m/z. Critical parameters include: gas 1 (nebulizer gas) at 40 psi, gas 2 (heating gas) at 40 psi, curtain gas at 30 psi, spray voltage at 5500 V, turbo spray temperature at 450°C, with collision energy in MS at 10 V and in MS/MS at 40 V . Phosphorylation, the most common PTM affecting photosystem proteins, can be specifically detected using phospho-specific antibodies or Phos-tag SDS-PAGE. Enrichment techniques like IMAC (Immobilized Metal Affinity Chromatography) prior to MS analysis significantly improve detection sensitivity for low-abundance modified PSAG.

What are the optimal expression systems for producing functional recombinant Spinacia oleracea PSAG?

Several expression systems can be used for recombinant PSAG production, each with specific advantages depending on research objectives. For structural studies requiring high purity and native conformation, the most effective approach is a plant-based expression system using Nicotiana benthamiana transient expression mediated by Agrobacterium infiltration. This system maintains the chloroplastic targeting and processing machinery necessary for proper PSAG folding and minimal post-translational modification artifacts. For biochemical assays requiring higher yields, E. coli-based expression using specialized strains (like BL21(DE3) with pLysS) transformed with a codon-optimized PSAG sequence fused to a cleavable N-terminal His-tag is recommended. Expression should be induced at lower temperatures (16-18°C) with reduced IPTG concentrations (0.1-0.3 mM) to promote proper folding. For functional studies, a yeast system (Pichia pastoris) offers a compromise between yield and post-translational processing capability.

How can researchers validate the functionality of recombinant PSAG preparations?

Validation of recombinant PSAG functionality requires multiple complementary approaches. First, researchers should perform spectroscopic analysis to confirm proper folding and cofactor binding, with characteristic absorption peaks indicating intact protein structure. Electron transport assays using artificial electron donors and acceptors can confirm the protein's ability to participate in electron transfer reactions. Reconstitution experiments, where recombinant PSAG is incorporated into PSAG-depleted thylakoid membranes, provide the most definitive functional validation. Researchers should measure oxygen evolution rates or fluorescence parameters before and after reconstitution to quantify functional recovery. Additionally, thermal stability assays comparing recombinant versus native PSAG provide valuable information about structural integrity, with closely matching denaturation profiles indicating properly folded recombinant protein.

What controls should be included when studying PSAG interactions with other photosystem components?

Rigorous control experiments are essential when studying PSAG interactions. Negative controls should include non-photosynthetic proteins of similar size and charge properties to rule out non-specific interactions. When using immunoprecipitation techniques, researchers should employ protocols similar to those used for spinach protein studies: incubating 100 μl of protein extract with appropriate antibodies (20 μl) on ice for 10 minutes, followed by precipitation using agents like Immunoprecipitin . Pull-down assays should include both N-terminal and C-terminal tagged versions of PSAG to ensure tag position doesn't interfere with interactions. Competitive binding assays using excess untagged PSAG help confirm specificity. For in vivo interaction studies, FRET (Förster Resonance Energy Transfer) controls should include donor-only and acceptor-only samples, along with non-interacting protein pairs as baseline references. Size exclusion chromatography combined with multi-angle light scattering provides valuable confirmation of complex formation and stoichiometry.

How should researchers interpret discrepancies between in vitro and in vivo PSAG studies?

Discrepancies between in vitro and in vivo PSAG studies often arise from differences in the protein's environment and interaction partners. When analyzing such discrepancies, researchers should first consider the lipid composition differences, as thylakoid membranes contain specialized lipids crucial for photosystem function. Statistical analysis should employ one-way ANOVA with post-hoc Tukey's test for multiple comparisons, with p<0.05 considered statistically significant . Confirmatory experiments should include membrane reconstitution assays with varying lipid compositions to determine environmental factors affecting PSAG function. Researchers should also consider that PSAG activity may be modulated by regulatory proteins in vivo that are absent in purified systems. To address this, parallel experiments using isolated chloroplasts (representing the in vivo state) and purified components (representing in vitro conditions) can help identify missing factors. Time-resolved studies can also reveal kinetic differences that might explain functional discrepancies between the two experimental approaches.

What analytical methods are most effective for detecting PSAG structural changes under different physiological conditions?

Multiple biophysical techniques can effectively detect PSAG structural changes. Circular dichroism (CD) spectroscopy in the far-UV range (190-250 nm) provides valuable information about secondary structure changes, while near-UV CD (250-350 nm) reveals tertiary structure alterations. For higher resolution analysis, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map specific regions undergoing conformational changes with 3-5 peptide resolution. This technique is particularly valuable for monitoring PSAG responses to different physiological conditions like pH, salt concentration, or interaction partners. Förster resonance energy transfer (FRET) between strategically placed fluorophores can detect more subtle conformational changes in real-time. For the highest resolution analysis, cryo-electron microscopy of PSAG within the photosystem complex under different conditions can reveal atomic-level structural changes. Data analysis should involve multivariate statistical approaches to distinguish significant structural changes from experimental variation.

How can conflicting results about PSAG function be reconciled in the context of different experimental systems?

Conflicting results about PSAG function often stem from variations in experimental systems. When encountering contradictory findings, researchers should systematically analyze differences in protein source (native vs. recombinant), purification methods, assay conditions, and detection techniques. For native PSAG studies, genetic variations between different Spinacia oleracea cultivars may contribute to functional differences, as demonstrated by genetic diversity studies showing significant variation among spinach landraces from different geographical regions . Statistical meta-analysis combining data from multiple studies can help identify consistent trends despite methodological variations. Researchers should also consider ontological effects, as PSAG function may vary with plant developmental stage or growth conditions. Standardized reporting of experimental parameters—including precise buffer compositions, temperature, light conditions, and plant growth stages—is essential for meaningful cross-study comparisons and reconciliation of conflicting results.

How might PSAG contribute to stress tolerance mechanisms in Spinacia oleracea?

PSAG likely plays an important role in spinach stress response mechanisms, particularly in oxidative stress conditions. Spinach contains numerous bioactive compounds with significant anti-inflammatory and antioxidant properties that help maintain cellular homeostasis under stress conditions . Research investigating the relationship between PSAG and stress response should monitor changes in PSAG expression levels and post-translational modifications during exposure to different stressors. Potential protective mechanisms may involve PSAG structural adaptations that maintain photosystem efficiency under suboptimal conditions. Experimental approaches should include comparative proteomics of stress-exposed versus control plants, focusing on PSAG abundance and modification state. RNA-seq analysis can reveal transcriptional regulation patterns of PSAG under stress. Understanding these mechanisms could lead to engineering stress-tolerant varieties with enhanced photosynthetic efficiency under adverse conditions.

What novel methodologies are emerging for studying PSAG function and dynamics?

Emerging methodologies for PSAG research include several cutting-edge approaches. Single-molecule techniques like total internal reflection fluorescence microscopy (TIRFM) can track individual PSAG molecules within membrane environments, revealing dynamic behaviors invisible to bulk measurements. Advanced mass spectrometry methods, similar to those used for analyzing spinach extract components (with LC-TOF/MS using RP-C18 columns and optimized gradients), enable precise identification of PSAG modifications and interaction partners . Cryo-electron tomography of intact chloroplasts provides structural context for PSAG function within the native thylakoid membrane architecture. Optogenetic approaches using light-sensitive protein fusions allow precise temporal control of PSAG interactions or conformational changes. CRISPR-based techniques for targeted PSAG modification in spinach chloroplasts are also emerging, enabling precise structure-function studies through directed mutagenesis of specific PSAG domains while maintaining the native expression context.

How can PSAG research contribute to understanding broader aspects of plant adaptation and evolution?

PSAG research offers valuable insights into plant adaptation and evolution. Comparative analysis of PSAG sequence and structure across species can reveal evolutionary patterns in photosystem development. The genetic relationships between cultivated spinach and wild relatives (S. turkestanica and S. tetrandra) provide a framework for understanding PSAG evolution . Researchers should examine PSAG variations across these related species to identify conserved functional domains versus regions subject to adaptive evolution. Geographic distribution analysis of PSAG variants can be correlated with environmental factors to identify adaptive signatures. This approach is particularly relevant given that spinach domestication likely occurred in regions including Afghanistan and Pakistan, with subsequent introduction to China via Nepal . Functional studies comparing PSAG from plants adapted to different light environments can reveal how photosystem components evolve in response to specific ecological niches. Integration of PSAG structural data with whole-genome evolutionary analyses can place photosystem adaptation in the broader context of plant evolutionary history.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.