Recombinant Spinacia oleracea Photosystem I reaction center subunit XI, chloroplastic (PSAL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PSAL; Photosystem I reaction center subunit XI, chloroplastic; PSI-L; PSI subunit V
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-216
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Names
PSAL
Target Protein Sequence
AIKTEKPTYQVIQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLA HGFLLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSMCLTMYGIASFKEGEPSIAPALT LTGRKKQPDQLQSADGWAKFTGGFFFGGVSGVTWACFLMYVLDLPYYFK
Uniprot No.

Target Background

Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is PSAL and what is its role in photosynthesis?

PSAL (Photosystem I reaction center subunit XI, chloroplastic) is an 18.8 kDa protein component of the photosystem I (PSI) complex in spinach. It is encoded by a single-copy nuclear gene and functions as an integral membrane protein within the PSI reaction center. The mature protein consists of approximately 169 amino acid residues and contains two predicted transmembrane segments based on hydropathy analysis . PSAL plays a structural role in the PSI complex, helping to maintain the proper conformation of the reaction center and contributing to efficient light harvesting and electron transport during photosynthesis.

How is recombinant PSAL typically expressed and purified?

Recombinant PSAL from Spinacia oleracea is commonly expressed in E. coli expression systems using appropriate vectors. The protein is typically expressed with an N-terminal histidine tag to facilitate purification. Following expression, cells are harvested and lysed, and the recombinant protein is purified using affinity chromatography (typically Ni-NTA resin for His-tagged proteins), followed by additional purification steps such as ion exchange or size exclusion chromatography if needed. The purified protein is often available as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE .

What experimental controls should be used when working with recombinant PSAL?

When designing experiments with recombinant PSAL, several controls should be implemented to ensure valid results:

  • Negative controls: Include samples without the recombinant protein to establish baseline measurements.

  • Positive controls: Use well-characterized proteins of similar size or structure when possible.

  • Vector-only controls: Express and purify product from cells containing the expression vector without the PSAL insert.

  • Native protein comparison: When possible, compare results with native PSAL isolated from spinach chloroplasts.

  • Validation controls: Confirm protein identity via western blotting, mass spectrometry, or N-terminal sequencing .

These controls help distinguish experimental artifacts from genuine biological effects and strengthen the validity of research findings .

How can I design experiments to study PSAL interaction with other photosystem components?

To investigate PSAL interactions with other photosystem components, consider employing these methodological approaches:

  • Co-immunoprecipitation studies: Use antibodies against PSAL to pull down protein complexes, followed by mass spectrometry to identify interacting partners.

  • Crosslinking experiments: Utilize chemical crosslinkers of varying lengths to capture transient or weak interactions between PSAL and other proteins.

  • Yeast two-hybrid or split-GFP assays: For binary interaction detection, though membrane protein interactions may require specialized versions of these techniques.

  • Experimental design considerations: Implement independent measures design with appropriate controls when comparing wild-type versus mutant interactions .

Experimental ApproachAdvantagesLimitationsKey Controls
Co-immunoprecipitationDetects native complexesMay lose weak interactionsIgG control, input lysate
CrosslinkingCaptures transient interactionsMay produce artifactsNon-crosslinked samples
Fluorescence resonance energy transferIn vivo detectionRequires protein taggingDonor/acceptor only controls
Surface plasmon resonanceQuantitative binding kineticsRequires purified componentsReference channel, buffer controls

When analyzing results, apply rigorous statistical methods to distinguish significant interactions from background .

What approaches can be used to study the transit peptide processing of PSAL?

The transit peptide processing of PSAL can be studied through several methodological approaches:

  • In vitro import assays: Express the full precursor protein (24 kDa, 216 residues) in a cell-free system and incubate with isolated chloroplasts. The precursor can be efficiently imported into isolated spinach chloroplasts, where it is correctly processed to the mature size and integrates into the photosystem I assembly .

  • Site-directed mutagenesis: Introduce mutations at potential cleavage sites to identify critical residues for processing.

  • Mass spectrometry analysis: Compare the N-terminal sequences of mature versus precursor forms to precisely map the cleavage site.

  • Transit peptide prediction validation: Compare computational predictions from tools like TargetP with experimental results to refine prediction algorithms .

  • Pulse-chase experiments: Track the kinetics of processing by labeling newly synthesized precursors and following their maturation over time.

These approaches should incorporate repeated measures design where appropriate to minimize variability and increase statistical power .

How can evolutionary analysis of PSAL inform structure-function relationships?

Evolutionary analysis of PSAL can provide valuable insights into structure-function relationships through these methodological approaches:

  • Comparative sequence analysis: Align PSAL sequences across diverse photosynthetic organisms to identify conserved residues likely critical for function.

  • Selection pressure analysis: Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS) to identify residues under positive or purifying selection. This approach can be implemented using the free-ratio model (m1) allowing branch-specific ω as described for plastid genes .

  • Ancestral sequence reconstruction: Infer ancestral PSAL sequences to track evolutionary changes and potentially identify functional adaptations.

  • Co-evolution analysis: Identify co-evolving residues within PSAL or between PSAL and other photosystem components, which may indicate functional or structural interactions.

  • Experimental validation: Test predictions from evolutionary analyses using site-directed mutagenesis of conserved or rapidly evolving residues.

When analyzing evolutionary data, implement appropriate statistical tests such as likelihood ratio tests (LRTs) between different branch models to determine if genes have elevated evolutionary rates in specific lineages .

What are the best methods for studying the membrane topology of PSAL?

To investigate the membrane topology of PSAL, which contains two predicted transmembrane segments, researchers should consider these methodological approaches:

  • Protease protection assays: Treat isolated thylakoid membranes with proteases and analyze the protected fragments to determine which regions are embedded in the membrane.

  • Cysteine scanning mutagenesis: Systematically introduce cysteine residues throughout the protein and assess their accessibility to membrane-impermeant thiol-reactive reagents.

  • Fluorescence spectroscopy: Introduce fluorescent probes at specific sites and measure their emission properties to determine the local environment (aqueous vs. membrane).

  • Cryo-electron microscopy: For higher-resolution structural information, analyze the protein within the context of the entire PSI complex.

  • Hydropathy analysis validation: Compare computational predictions with experimental results. The hydropathy analysis of PSAL suggests the presence of two transmembrane segments .

These approaches should use independent measures design with appropriate controls to ensure reproducibility and reliability of results .

How should I design experiments to study PSAL function in reconstituted systems?

When designing experiments to study PSAL function in reconstituted systems, consider these methodological guidelines:

  • System preparation: Incorporate purified recombinant PSAL (>90% purity by SDS-PAGE) into liposomes or nanodiscs that mimic the native lipid environment of thylakoid membranes .

  • Experimental design: Implement a factorial design that systematically varies parameters such as lipid composition, protein concentration, and the presence of other PSI components.

  • Control considerations:

    • Include lipid-only controls

    • Compare with denatured protein controls

    • Use unrelated membrane proteins as negative controls

    • When possible, include native PSI preparations as positive controls

  • Functional measurements: Assess electron transport capability through spectroscopic methods (e.g., P700 oxidation kinetics) or artificial electron donor/acceptor systems.

  • Statistical analysis: Apply repeated measures ANOVA when comparing multiple conditions with the same preparation to account for preparation-to-preparation variability .

Careful consideration of these methodological aspects will help ensure valid and reproducible results when studying PSAL in reconstituted systems.

What are the key considerations for successful expression and purification of functional PSAL?

Successful expression and purification of functional PSAL requires attention to several critical factors:

  • Expression system selection: E. coli is commonly used, but consider eukaryotic systems for proper post-translational modifications if needed. Recombinant PSAL has been successfully expressed in E. coli with an N-terminal His tag .

  • Construct design:

    • Include appropriate affinity tags (His-tag is commonly used)

    • Consider the presence or absence of the transit peptide (amino acids 1-47)

    • Optimize codon usage for the expression host

  • Solubilization strategy:

    • Select appropriate detergents (mild non-ionic detergents often preserve function)

    • Test different detergent concentrations and solubilization times

    • Consider temperature effects during solubilization

  • Purification protocol:

    • Implement multi-step purification (affinity chromatography followed by size exclusion)

    • Maintain protein stability with appropriate buffers containing glycerol (5-50%)

    • Avoid repeated freeze-thaw cycles

  • Quality control:

    • Verify purity by SDS-PAGE (target >90%)

    • Confirm identity by mass spectrometry or western blotting

    • Assess structural integrity through circular dichroism or fluorescence spectroscopy

The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C .

How can I effectively analyze and interpret experimental data related to PSAL function?

To effectively analyze and interpret experimental data related to PSAL function, follow these methodological principles:

When analyzing nucleotide or amino acid sequences, implement established bioinformatic tools such as MAFFT for alignment and appropriate evolutionary models for rate estimations. For codon-based analyses, consider models like F3×4 as used in studies of other plastid proteins .

What are common challenges in working with recombinant PSAL and how can they be addressed?

Researchers working with recombinant PSAL may encounter several challenges, which can be addressed through these methodological solutions:

  • Low expression levels:

    • Optimize growth conditions (temperature, induction time, media composition)

    • Try different E. coli strains (BL21(DE3), Rosetta, C41/C43 for membrane proteins)

    • Redesign constructs with optimized codon usage

    • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Protein aggregation:

    • Adjust solubilization conditions (detergent type and concentration)

    • Reduce expression temperature (e.g., 16-20°C)

    • Include appropriate additives (glycerol, reducing agents)

    • Explore on-column refolding strategies

  • Improper folding:

    • Co-express with molecular chaperones

    • Use mild solubilization and purification conditions

    • Implement quality control checks using circular dichroism

  • Functional assessment challenges:

    • Develop activity assays that don't require the complete PSI complex

    • Consider complementation assays in mutant systems

    • Use spectroscopic methods to assess structural integrity

  • Stability issues during storage:

    • Optimize buffer composition (pH, salt concentration)

    • Add stabilizing agents (trehalose at 6% is recommended)

    • Store as aliquots to avoid repeated freeze-thaw cycles

    • For long-term storage, lyophilization or storage at -80°C with 50% glycerol is recommended

Each optimization step should follow the principles of experimental design, with appropriate controls and systematic parameter variation .

How can I validate that my recombinant PSAL is correctly folded and functional?

Validating the correct folding and functionality of recombinant PSAL requires a multi-faceted approach:

  • Structural validation methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Size exclusion chromatography to confirm monomeric state or appropriate oligomerization

    • Limited proteolysis to probe accessible regions (properly folded proteins often show distinctive digestion patterns)

  • Functional validation approaches:

    • Reconstitution into liposomes and assessment of interaction with other PSI components

    • Complementation assays in PSAL-deficient systems

    • Binding studies with known interaction partners

    • Electron transfer measurements in reconstituted systems

  • Biochemical property assessment:

    • Thermal stability assays (differential scanning fluorimetry)

    • Chemical denaturation profiles

    • Comparison with native protein when available

  • Control experiments:

    • Parallel analysis of denatured protein samples

    • Comparison with well-characterized membrane proteins of similar size/structure

    • Analysis of mutant variants with predicted functional defects

The experimental design should include appropriate positive and negative controls, with repeated measures to ensure reliability and reproducibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.