Recombinant Spinacia oleracea Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Photosystem II

CP47 is indispensable for PSII stability and water-splitting activity:

  • Light Harvesting: Transfers excitation energy to the PSII reaction center (D1/D2 proteins) .

  • Oxygen Evolution: The E-loop anchors extrinsic proteins (PsbO, PsbP) essential for maintaining the Mn4CaO5 cluster .

  • Assembly: Forms a pre-CP47 subcomplex with PsbH, PsbL, and PsbTc during PSII biogenesis . Mutants lacking CP47 fail to assemble functional PSII monomers .

Biogenesis and Assembly Factors

CP47 insertion into thylakoid membranes requires co-translational assistance:

  • FPB1 and PAM68: Facilitate TMD folding and integration. Ribosome profiling reveals stalling during translation of CP47’s final TMD in fpb1 mutants .

  • HCF107/Mbb1: RNA-binding proteins stabilizing psbB mRNA and enabling CP47 synthesis .

Assembly Factors

FactorRoleOrganism
FPB1Co-translational membrane insertionArabidopsis
PAM68Synergistic with FPB1Arabidopsis
HCF107Stabilizes psbB mRNAArabidopsis
Mbb1Processes psbB 5’-end RNAChlamydomonas

Genetic and Transcriptional Context

The psbB operon in spinach includes psbB, psbT, psbH, petB, and petD . Key features:

  • Polycistronic Transcription: Produces 18 RNA species via processing rather than multiple promoters .

  • Evolution: Conserved in vascular plants but varies in algae (e.g., intron loss in Chara vulgaris) .

  • RNA Editing: A conserved C-to-U edit in petB (position 204) alters Pro→Leu, critical for cytochrome b6 function .

Operon Comparison Across Species

SpeciespsbB Operon StructureIntrons?
Spinacia oleraceapsbB-psbT-psbH-petB-petDYes (group II)
Chara vulgarispsbB-psbT-psbH-petB-petDNo (petD)
ChlamydomonasDisrupted clustersVariable

Research Applications

  • PSII Assembly Studies: fpb1/pam68 mutants reveal CP47’s dependence on co-translational factors .

  • Structural Biology: High-resolution crystallography (e.g., PsbQ at 1.49 Å ) leverages recombinant proteins to map PSII interactions.

  • Biotechnology: Engineered CP47 variants could optimize light harvesting in synthetic photosynthesis systems .

Challenges and Future Directions

While recombinant CP47 enables mechanistic studies, unresolved questions include:

  • The role of PsbN (encoded on the antisense strand of psbB operon) in PSII .

  • Structural dynamics of the E-loop during photodamage repair .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your consideration.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Spinacia oleracea (Spinach)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITDPGIWSYEGVAGAHIMFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VSPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSFSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLIDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDVQVEFGAFQKIGDPTTRRQGV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. CP47 binds chlorophyll and facilitates the primary light-driven photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, producing O₂ and a proton gradient subsequently used for ATP synthesis.

Database Links

KEGG: soe:2715608

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.