Recombinant Spinacia oleracea Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your requests whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our standard shipping for all proteins includes normal blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes a final glycerol concentration of 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; 32 kDa thylakoid membrane protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Spinacia oleracea (Spinach)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
This protein is one of the two reaction center proteins found in photosystem II. Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: soe:2715607

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein and what is its role in photosynthesis?

Photosystem Q(B) protein, also known as D1 protein or PsbA, is a core component of Photosystem II (PSII) in the photosynthetic apparatus. It serves as the binding site for the secondary electron acceptor (QB) in the electron transport chain during the light-dependent reactions of photosynthesis. This 32 kDa thylakoid membrane protein receives electrons from the primary acceptor (QA) and transfers them further along the electron transport chain, making it crucial for converting light energy into chemical energy . The protein is encoded by the psbA gene and in Spinacia oleracea, the mature protein spans positions 2-344, containing multiple transmembrane domains that anchor it within the thylakoid membrane and position electron transport cofactors appropriately .

How does the structure of Photosystem Q(B) protein relate to electron transfer mechanisms?

The structure of Photosystem Q(B) protein is intricately designed to facilitate efficient electron transfer during photosynthesis. Its multiple transmembrane helices create specific binding pockets for electron transport cofactors, particularly the QA and QB quinone binding sites. Research has demonstrated that even minor modifications to the protein's structure, especially around the QA binding site, can significantly impact electron transfer rates .

Recent studies have revealed that engineering the environment of the QA site can increase the reduction rate of artificial electron mediators like 2,6-dimethyl-p-benzoquinone (DMBQ), potentially creating novel electron donation pathways . The protein's structure creates the precise microenvironment required for electron transfer, with specific regions that undergo conformational changes during the process to facilitate the binding and release of electron carriers. These structural features maintain the redox potentials necessary for directional electron flow through the photosystem complex.

What are the optimal storage conditions for recombinant Photosystem Q(B) protein?

Proper storage of recombinant Photosystem Q(B) protein is critical for maintaining its stability and functional integrity. Based on established protocols, the following storage guidelines are recommended:

  • Long-term storage: Store at -20°C to -80°C, with -80°C being preferable for extended periods to minimize degradation .

  • Aliquoting: Upon receipt, divide the protein into multiple small aliquots to avoid repeated freeze-thaw cycles, which significantly degrade the protein. Working aliquots can be stored at 4°C for up to one week .

  • Buffer composition: The protein exhibits optimal stability in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

  • Cryoprotection: Adding glycerol to a final concentration of 50% is recommended for long-term storage to prevent ice crystal formation that can damage protein structure .

  • Reconstitution: When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. Briefly centrifuge the vial prior to opening to bring contents to the bottom .

It is particularly important to note that repeated freezing and thawing is especially detrimental to this protein and should be strictly avoided through proper aliquoting .

What methods can be used to verify the purity and integrity of recombinant Photosystem Q(B) protein preparations?

Assessing the purity and integrity of recombinant Photosystem Q(B) protein preparations is essential for ensuring reliable experimental results. Several complementary techniques should be employed:

  • SDS-PAGE analysis: This standard method should show a single predominant band at approximately 32 kDa, with purity greater than 90% . High-quality preparations should be free of significant degradation products.

  • Western blotting: For more specific detection, use antibodies against either the Photosystem Q(B) protein itself or the His-tag (if present) to confirm protein identity and detect any degradation products.

  • Spectroscopic analysis: Absorption spectra can verify the presence of bound cofactors and proper protein folding. Properly folded photosystem proteins exhibit characteristic absorbance patterns.

  • Functional assays: Electron transfer activity measurements using artificial electron acceptors like DMBQ can confirm that the protein is functionally intact . Changes in activity may indicate protein degradation or denaturation.

  • Mass spectrometry: For the most detailed analysis, mass spectrometry can confirm the exact mass of the protein and identify any post-translational modifications or truncations.

Research on related photosystem proteins has demonstrated that SDS-PAGE analysis of dissolved protein crystals can verify intact protein without significant degradation, which is particularly important for structural studies .

What crystallization strategies have been successful for Photosystem II proteins from Spinacia oleracea?

Crystallization of Photosystem II proteins from Spinacia oleracea requires carefully optimized conditions to obtain diffraction-quality crystals. Based on successful approaches with related proteins like PsbP, the following methodology is recommended:

  • Protein preparation:

    • Ensure high purity (>95% by SDS-PAGE)

    • For His-tagged proteins, consider thrombin digestion to remove the tag prior to crystallization attempts

    • Buffer exchange into a low-ionic-strength buffer (e.g., bis-Tris pH 6.0 has proven effective for PsbP protein)

  • Crystallization technique:

    • The sitting-drop vapor-diffusion method has been successfully employed

    • Typically use 1-2 μL of protein solution mixed with an equal volume of reservoir solution

    • Incubate at controlled temperature (typically 18-20°C) in the dark to prevent light-induced damage

  • Successful crystallization conditions for PsbP protein from spinach:

    • PEG 550 MME as a precipitant

    • Addition of zinc sulfate as an additive

    • Crystals obtained with these conditions diffracted to 2.06 Å resolution in space group P2₁2₁2₁

ParameterOptimized Condition
MethodSitting-drop vapor-diffusion
Bufferbis-Tris pH 6.0
PrecipitantPEG 550 MME
AdditiveZinc sulfate
Space groupP2₁2₁2₁
Unit-cell parametersa = 38.68, b = 46.73, c = 88.9 Å
Resolution2.06 Å

While these conditions were established for PsbP protein, they may serve as a starting point for crystallization attempts with Photosystem Q(B) protein, though optimization will likely be necessary .

How can researchers prevent protein degradation during crystallization experiments?

Preventing protein degradation during crystallization of Photosystem Q(B) protein is crucial for obtaining high-quality diffraction data. Research on related photosystem proteins has established several effective approaches:

  • Buffer optimization:

    • Carefully select buffer pH to minimize degradation (pH 6.0 has been successful for PsbP protein)

    • Include stabilizing additives such as trehalose or glycerol

    • Consider the addition of specific metal ions that might stabilize the protein structure

  • Protein handling:

    • Maintain samples at 4°C during all preparation steps

    • Work quickly to minimize time at room temperature

    • Use freshly purified protein when possible

  • Protease inhibition:

    • Add appropriate protease inhibitor cocktails during purification

    • Consider including specific inhibitors in crystallization drops

    • Use protease-deficient expression systems when possible

  • Quality assessment:

    • Regularly analyze aliquots by SDS-PAGE to monitor stability over time

    • Compare dissolved crystals by SDS-PAGE to verify absence of degradation products

    • Implement pre-crystallization tests to identify optimal stabilizing conditions

Research with PsbP protein from spinach demonstrated that storing the protein in bis-Tris buffer at pH 6.00 and using thrombin-digested recombinant His-tagged protein prevented degradation and yielded high-quality crystals diffracting to 2.06 Å . This methodological approach highlights the importance of buffer optimization and careful protein handling for successful crystallization experiments with photosystem proteins.

What techniques can measure electron transfer activity in recombinant Photosystem Q(B) protein?

Several sophisticated techniques are available for measuring electron transfer activity in recombinant Photosystem Q(B) protein, each providing unique insights:

  • Artificial electron acceptor assays:

    • 2,6-dimethyl-p-benzoquinone (DMBQ) has been successfully used as an electron mediator to assess electron transfer from QA to artificial acceptors

    • The reduction of DMBQ can be monitored spectrophotometrically and provides a quantitative measure of electron transfer capability

  • Chronoamperometry:

    • This electrochemical technique measures sustained electron transfer in real-time

    • Has been used to confirm successful electron transfer to DMBQ in systems with modified QA sites

    • Provides direct evidence of electron flow from the photosystem to external acceptors

  • Chlorophyll fluorescence analysis:

    • Parameters such as F₀ (minimum fluorescence), Fm (maximum fluorescence), and Fv/Fm (variable/maximum fluorescence) ratio provide insights into PSII photochemical efficiency

    • The FluorPen FP 110 and similar devices can be used to measure these parameters in reconstituted systems

    • Changes in these values can indicate alterations in electron transfer efficiency

  • Electron Transport Rate (ETR) measurements:

    • Quantifies the rate of electron flow through the photosystem in μmol m⁻² s⁻¹

    • Can be measured using devices like the LI-600 Porometer/Fluorometer

    • Provides direct information about photosystem functionality under different conditions

Recent research has demonstrated that modifying the environment of the QA site through structural engineering can significantly increase the reduction rate of artificial electron mediators, providing a valuable approach for assessing functional modifications of Photosystem Q(B) protein .

How does the QA binding site modification affect electron transfer pathways in Photosystem II?

Modification of the QA binding site in Photosystem II has significant effects on electron transfer pathways and efficiency. Recent research has provided detailed insights into these effects:

  • Engineering novel electron donation pathways:

    • Site-directed mutations that modify the QA binding site environment can create alternative electron transfer routes

    • These modifications can increase the reduction rate of artificial electron acceptors like DMBQ

    • Such engineering approaches potentially allow electrons to bypass the natural QA to QB pathway

  • Critical structural factors:

    • The distance between QA and potential electron acceptors is crucial for efficient transfer

    • Truncating the C-terminus of the PsbT subunit, which protrudes into the stroma, has been shown to enhance electron transfer to external acceptors

    • This demonstrates that shortening the distance between QA and artificial acceptors leads to sustained electron transfer

  • Experimental validation:

    • Chronoamperometry measurements confirm sustained electron transfer in engineered systems

    • These modifications can be achieved without compromising photosynthetic capabilities

    • Structural prediction studies combined with site-directed mutant screening provide an effective methodology for identifying beneficial modifications

  • Applications:

    • Modified photosystems with engineered electron transfer pathways show promise for improving biophotovoltaic devices

    • Current limitations in biophotovoltaics include kinetic constraints that result in lower-than-theoretical conversion efficiencies

    • Engineered photosystems may help overcome these limitations by optimizing electron extraction

These findings highlight that rational engineering approaches can modify electron transfer pathways for specific applications while providing valuable insights into fundamental electron transfer mechanisms within Photosystem II .

How do different light spectra influence Photosystem II efficiency in experimental systems?

Light spectral composition has profound effects on Photosystem II efficiency in Spinacia oleracea, with significant implications for research using recombinant photosystem proteins. Recent studies have revealed several key relationships:

  • Effects on chlorophyll content and composition:

    • Different light spectra (e.g., BR: Blue-Red, BGR: Blue-Green-Red, GR: Green-Red) result in varying chlorophyll accumulation patterns

    • These differences in pigment composition directly affect light harvesting capacity and energy transfer to reaction centers

  • Photosystem II quantum efficiency response:

    • F₀ (minimum fluorescence) in dark-adapted spinach leaves was lower under BGR and GR lights compared to BR light

    • These differences indicate spectral effects on energy dissipation within the light-harvesting complexes

  • Electron transport rate (ETR) variations:

    • ETR (μmol m⁻² s⁻¹) varies significantly with spectral composition

    • Research has shown that ETR may be significantly lower under BR light compared to BGR and GR light treatments

    • These differences highlight the importance of spectral composition for optimizing photosynthetic electron flow

  • Interactive effects with nitrogen availability:

    • A significant interaction exists between light spectra and nitrogen levels for parameters like ETR and stomatal conductance

    • Under nitrogen limitation, the impact on photosystem efficiency depends on the light spectrum

Light TreatmentF₀ ResponseETRResponse to N Limitation
BR (Blue-Red)HigherLowerLess affected
BGR (Blue-Green-Red)LowerHigherModerately affected
GR (Green-Red)LowerHigherStrongly affected

These findings have important implications for experimental design when working with recombinant Photosystem II proteins. The light conditions should be carefully controlled and reported, as they significantly affect the measured parameters and experimental outcomes .

What is the relationship between nitrogen availability and Photosystem II function?

Nitrogen availability significantly impacts Photosystem II function, with important implications for research using recombinant photosystem proteins. Recent studies have revealed several key aspects of this relationship:

  • Effects on photosystem composition:

    • Nitrogen limitation affects the synthesis of chlorophyll and photosystem proteins

    • These compositional changes directly impact photosystem function and electron transport efficiency

  • Quantum efficiency responses:

    • The quantum efficiency of PSII (PhiPS2) typically decreases with declining nitrogen availability

    • This response appears consistent across different light spectral compositions

  • Electron transport and stomatal conductance:

    • Electron transport rate (ETR) may remain stable despite nitrogen limitation under certain light conditions

    • Stomatal conductance (gsw) typically decreases under nitrogen limitation, particularly under specific light spectra (BGR and GR)

  • Complex interactive effects:

    • Under GR light, plants exhibited higher instantaneous chlorophyll fluorescence (Ft) and lower quantum yield (QY) when subjected to limited nitrogen

    • This interaction highlights the complexity of environmental factors affecting photosystem function

  • Research implications:

    • Nitrogen status of source material may affect isolated photosystem protein properties

    • Standardization of nitrogen conditions is crucial for reproducible results

    • Experimental design should account for potential interactions between nitrogen status and light conditions

These findings emphasize the importance of controlling and reporting nitrogen conditions in research involving photosystem proteins from Spinacia oleracea, as the complex interactions between nitrogen availability and photosystem function significantly impact experimental outcomes .

How can recombinant Photosystem Q(B) protein be utilized for biophotovoltaic applications?

Recombinant Photosystem Q(B) protein offers significant potential for biophotovoltaic applications, with several promising approaches emerging from recent research:

  • Engineered electron transfer pathways:

    • Modification of the QA binding site environment can create novel electron donation pathways optimized for electricity generation

    • These modifications can increase the reduction rate of artificial electron acceptors used in biophotovoltaic devices

    • Site-directed mutagenesis can optimize electron transfer to electrodes

  • Structural optimization:

    • Truncating protein regions that increase the distance between electron carriers and electrodes has shown promising results

    • Shortening the distance between QA and artificial acceptors leads to sustained electron transfer, as confirmed by chronoamperometry

    • These approaches can help bypass the natural electron transfer pathway to extract electrons more efficiently

  • Overcoming efficiency limitations:

    • Current biophotovoltaic systems operate far below theoretical conversion efficiency limits due to kinetic constraints

    • Engineering approaches that optimize electrical connectivity between photosystems and electrodes can improve performance

    • The modification of QA sites through structural prediction studies and site-directed mutagenesis has demonstrated increased electron transfer to artificial acceptors

  • Practical implementation:

    • Immobilization strategies must be developed to properly orient the protein on electrodes

    • Stability under operational conditions remains a significant challenge

    • Integration with other components of the photosynthetic apparatus may improve performance

Research has demonstrated that these engineering approaches can be implemented without compromising the photosynthetic properties of the organism, suggesting that optimized recombinant photosystem proteins may help overcome current limitations in biophotovoltaic efficiency .

What methodological approaches can improve the stability of recombinant Photosystem Q(B) protein?

Maintaining the stability of recombinant Photosystem Q(B) protein is crucial for both research applications and biotechnological implementations. Several methodological approaches have proven effective:

  • Storage optimization:

    • Store at -80°C rather than -20°C for long-term storage

    • Create multiple small aliquots to avoid repeated freeze-thaw cycles

    • Add glycerol to a final concentration of 50% for cryoprotection

    • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Buffer optimization:

    • Test different pH conditions to identify optimal stability (pH 6.0-8.0 range)

    • Include stabilizing additives such as trehalose, sucrose, or specific salts

    • For PsbP protein from spinach, bis-Tris buffer at pH 6.0 prevented degradation in crystallization studies

  • Handling procedures:

    • Keep samples on ice during all manipulation steps

    • Minimize exposure to light, particularly high-intensity light that can cause photodamage

    • Brief centrifugation prior to opening vials ensures all material is collected at the bottom

  • Reconstitution methods:

    • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Gently mix rather than vortex to avoid denaturation

    • For longer-term storage of reconstituted protein, add 5-50% glycerol (final concentration)

  • Protease protection:

    • Add appropriate protease inhibitors during purification and storage

    • Consider the specific proteases present in your expression system

    • For E. coli-expressed proteins, inhibitors against serine and cysteine proteases are particularly important

These approaches have been validated through research on photosystem proteins from spinach, demonstrating that proper handling and storage conditions are essential for maintaining protein integrity and functional activity .

How can researchers address protein degradation issues when working with Photosystem Q(B) protein?

Protein degradation is a common challenge when working with recombinant Photosystem Q(B) protein. The following methodological approaches can effectively address this issue:

  • Degradation identification:

    • Implement regular SDS-PAGE analysis to monitor protein integrity over time

    • Consider Western blotting with antibodies against different regions of the protein

    • Compare fresh preparations with stored samples to identify degradation patterns

  • Storage optimization:

    • Store at -80°C rather than -20°C for long-term storage

    • Create multiple small aliquots to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week, but should not be repeatedly frozen and thawed

  • Buffer formulation:

    • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for general storage

    • For specific applications like crystallization, bis-Tris buffer at pH 6.0 has been effective for preventing degradation of PsbP protein from spinach

    • Add glycerol to a final concentration of 50% for cryoprotection during long-term storage

  • Protease inhibition:

    • Add a comprehensive protease inhibitor cocktail during purification and storage

    • Consider specific inhibitors based on the proteases present in your expression system

    • Test different inhibitor combinations to identify the most effective approach

  • Physical handling:

    • Minimize time at room temperature

    • Keep samples on ice during all manipulation steps

    • Briefly centrifuge vials before opening to collect all material at the bottom

Research on PsbP protein from spinach demonstrated that careful buffer selection and handling procedures were critical for preventing degradation during crystallization studies, allowing researchers to obtain high-quality crystals diffracting to 2.06 Å . Similar approaches can be applied to Photosystem Q(B) protein to maintain integrity during research applications.

What factors can affect the electron transfer measurements in experimental systems?

Several factors can significantly impact electron transfer measurements in experimental systems containing recombinant Photosystem Q(B) protein. Understanding and controlling these factors is essential for obtaining reliable and reproducible results:

  • Light conditions:

    • Light spectral composition significantly affects photosystem efficiency measurements

    • Different light spectra (BR, BGR, GR) result in varying electron transport rates

    • Standardize light conditions and report spectral composition in detail

  • Redox environment:

    • The redox state of electron carriers affects electron transfer rates

    • Control oxygen levels, as oxygen can accept electrons and alter measurements

    • Include appropriate electron donors and acceptors at standardized concentrations

  • Protein structural integrity:

    • Even minor modifications to the QA binding site environment can significantly impact electron transfer rates

    • Verify protein integrity before measurements to ensure degradation is not affecting results

    • Consider how expression tags (e.g., His-tag) might influence electron transfer properties

  • Environmental parameters:

    • Temperature affects electron transfer kinetics and should be precisely controlled

    • pH influences the redox potentials of electron carriers and protein cofactors

    • Ionic strength can alter protein-protein interactions and electron transfer rates

  • Interaction with artificial electron acceptors:

    • The distance between QA and artificial electron acceptors is critical for efficient transfer

    • Modification of protein regions that increase this distance can enhance electron transfer to artificial acceptors

    • The choice of electron acceptor (e.g., DMBQ) significantly impacts measured transfer rates

  • Nitrogen status interaction:

    • Nitrogen availability affects photosystem efficiency and electron transport rates

    • A significant interaction exists between nitrogen levels and light spectral effects

    • Standardize nitrogen conditions when comparing electron transfer measurements

These factors highlight the importance of detailed methodological reporting and standardized experimental conditions when studying electron transfer in systems containing recombinant Photosystem Q(B) protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.