Recombinant Spirogyra maxima Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Spirogyra maxima (Green alga)
Target Names
petD
Target Protein Sequence
MGVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTIACNVGLAVLEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKF QNPFRRPVATTVFLFGTVVALWLGIGAALPIDKSLTLGLF
Uniprot No.

Target Background

Function

Function: A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the cytochrome b6-f complex and what role does the petD subunit play?

The cytochrome b6-f complex (Cyt b6f) is a membrane protein complex that plays pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis in plants and cyanobacteria. It connects photosystem II to photosystem I in the electron transport chain. The complex consists of four large subunits (including subunit 4, encoded by petD) responsible for organizing the electron transfer chain, and four small subunits unique to oxygenic photosynthesis .

Subunit 4 (petD) is essential for proper assembly and stability of the complex. It contains critical regions like the PEWY motif, which is involved in plastoquinol binding at the Qo site . Studies have shown that mutations in this motif can completely block electron transfer through the cytochrome b6-f complex .

  • Why is Spirogyra maxima petD studied in photosynthesis research?

Spirogyra maxima is a filamentous green alga belonging to the Zygnematophyceae class, which is considered to be closely related to the ancestor of land plants . Phylogenetic studies based on rbcL sequence data have shown that Spirogyra and its relatives occupy an important position in the evolutionary history of photosynthetic organisms .

The petD subunit from Spirogyra maxima provides valuable comparative data for understanding the evolution and function of the cytochrome b6-f complex across different photosynthetic lineages. Research on this protein contributes to our understanding of how electron transport mechanisms evolved in the green lineage and how structural variations in the cytochrome b6-f complex relate to functional adaptations in different photosynthetic organisms .

  • What expression systems are typically used for recombinant petD production?

The most common expression system for recombinant petD is the pET expression system in Escherichia coli. This system utilizes strong bacteriophage T7 transcription and translation signals, allowing the target protein to comprise more than 50% of the total cell protein within hours after induction .

For Spirogyra maxima petD specifically, the full-length protein (160 amino acids) is typically expressed with an N-terminal His-tag to facilitate purification . The recombinant protein is usually stored in a Tris/PBS-based buffer with 6% trehalose or 50% glycerol at pH 8.0 to maintain stability .

Advanced Research Questions

  • How do mutations or deletions of petD affect cytochrome b6-f complex stability and function?

Research has demonstrated that mutations or deletions in petD significantly impact both the stability and function of the cytochrome b6-f complex. Comparative data from various studies shows:

Mutation/DeletionEffect on Complex StabilityEffect on FunctionReference
PEWY → PWYENormal assembly but loss of plastoquinol bindingComplete block in electron transferZito et al., 1999
ΔpetNDecrease to 20-25% of wild type levelsOxygen evolution reduced to ~30% of wild typeRecent study, 2025
ΔpetGSevere reduction in complex formationSeverely impaired electron transferSchwenkert et al., 2007
ΔpetLReduction to ~50% of wild type, only monomers formPartial reduction in electron transferSchwenkert et al., 2007

The PEWY sequence in the EF loop of subunit IV is particularly critical, as mutation to PWYE resulted in complete inhibition of electron transfer despite normal assembly of the complex, indicating the sequence is essential for plastoquinol binding at the Qo site .

  • What methods are most effective for assessing recombinant petD incorporation into functional cytochrome b6-f complexes?

Multiple complementary approaches should be employed to assess the successful incorporation of recombinant petD into functional complexes:

Structural Incorporation Assessment:

  • Blue-Native PAGE followed by second-dimension SDS-PAGE to analyze complex formation and stability

  • Size exclusion chromatography to determine oligomeric state (monomer vs. dimer)

  • Immunoblot analysis with antibodies against different subunits of the complex

  • Density gradient ultracentrifugation to separate assembled complexes from free proteins

Functional Assessment:

  • Electrochromic shift measurements at 520 nm to monitor the electrogenic phase of electron transfer between hemes bL and bH

  • Oxygen evolution measurements with and without the electron carrier TMPD (N,N,N',N'-tetramethyl-p-phenylenediamine)

  • Sensitivity to specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone

  • State transition measurements using 77K fluorescence spectra and room temperature fluorescence kinetics

  • How does the cytochrome b6-f complex mediate state transitions, and how can this be studied using recombinant components?

The cytochrome b6-f complex plays a critical role in state transitions—the regulatory mechanism that balances excitation energy between photosystem I and photosystem II. Recent research has provided direct evidence that plastoquinol binding at the Qo site of the cytochrome b6-f complex is required for activation of the light-harvesting complex II (LHCII) kinase during state transitions .

Multiple lines of evidence support this role:

  • The pwye mutant (with altered Qo pocket) showed no fluorescence quenching in state II conditions relative to state I

  • In ΔpetN mutants, state transitions were completely abolished, as revealed by 77K fluorescence spectra

  • 33Pi labeling of phosphoproteins demonstrated that antenna proteins remained poorly phosphorylated in both state conditions in Qo site mutants

To study this function using recombinant components, researchers can:

  • Reconstitute purified recombinant components in liposomes and assess kinase activation in vitro

  • Perform complementation studies by introducing recombinant wild-type or mutant petD into knockout strains

  • Use fluorescence techniques to monitor state transitions in vivo in complemented strains

  • Employ site-directed mutagenesis of specific residues to identify key amino acids involved in kinase activation

  • What are the main challenges in maintaining stable pET expression plasmids for petD expression?

Several challenges exist in maintaining stable pET expression plasmids for petD expression, requiring specific strategies:

Plasmid Stability Issues:

The pET expression system can face stability issues due to several factors:

  • Basal expression of potentially toxic membrane proteins like petD can lead to plasmid instability

  • Loss of antibiotic resistance markers during long induction periods

  • Metabolic burden on host cells leading to selection for plasmid-free cells

Solutions and Best Practices:

  • Initial cloning should be performed in hosts lacking T7 RNA polymerase to prevent toxic protein expression

  • Use of tight control mechanisms like the T7lac promoter and addition of glucose to media to suppress basal expression

  • Use of hosts containing pLysS or pLysE plasmids that produce T7 lysozyme to inhibit basal T7 RNA polymerase activity

  • Proper selection of antibiotic resistance markers—efficiency varies depending on the host strain and induction time

  • Maintenance of shorter induction times (e.g., 2h versus 20h) to reduce plasmid loss

  • Storage of working aliquots at 4°C for up to one week to avoid repeated freeze-thaw cycles that may damage the protein

  • How do the structural features of Spirogyra maxima petD compare to those of other photosynthetic organisms?

Comparative analysis of petD amino acid sequences reveals both conserved and divergent features:

OrganismFull AA SequenceKey MotifsUnique Features
Spirogyra maximaMGVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPND... (160aa)PEWY motif, transmembrane helicesDistinctive N-terminal region
Emiliania huxleyiMSILKKPDLADPKLRAKLAKGMGHNYYGEPAWPND... (160aa)PEWY motif, transmembrane helicesDifferent N-terminus sequence

Structural analysis indicates that the petD protein contains several transmembrane helices, with the PEWY motif located in the EF loop region . This motif is highly conserved across photosynthetic organisms, highlighting its critical role in plastoquinol binding and electron transfer.

The amino acid sequence of Spirogyra maxima petD shows specific adaptations that may reflect the ecological niche of this freshwater alga. These adaptations could influence interactions with other subunits and potentially optimize electron transfer under particular environmental conditions .

  • What are the most reliable methods for assessing petD phylogeny across algal species?

Phylogenetic analysis of petD sequences provides valuable insights into evolutionary relationships among photosynthetic organisms. The following methods have proven effective:

DNA Sequence Analysis:

  • PCR amplification of the petD gene region using conserved primers

  • DNA sequencing of the amplified region

  • Multiple sequence alignment using programs like MUSCLE or CLUSTAL

  • Phylogenetic tree construction using maximum parsimony (MP), maximum likelihood (ML), and Bayesian inference (BI)

Supporting Analyses:

  • Inclusion of multiple genera as outgroups (e.g., from Zygnematales and Desmidiales)

  • Bootstrap replication (for MP and ML) and posterior probabilities (for BI) as measures of support

  • Correlation of molecular data with morphological characteristics (cell dimensions, chloroplast structure)

  • Inter simple sequence repeat (ISSR) markers for additional genetic profiling

A comprehensive study of Spirogyra and related genera using rbcL sequence data showed strong support for a single clade containing Spirogyra and Sirogonium . Similar approaches can be applied using petD sequences to further resolve phylogenetic relationships.

  • How can researchers optimize experimental conditions for inducing conjugation in Spirogyra to study reproductive processes?

Inducing conjugation in Spirogyra under laboratory conditions is valuable for studying reproductive processes and cell wall formation. Research indicates specific approaches are effective:

Optimal Conditions for Conjugation Induction:

  • Culture Spirogyra in nitrogen-deficient medium to stimulate conjugation

  • Maintain cultures under specific light conditions (8 h dark:16 h light at 30-35 μmol photons m−2s−1)

  • Use continuous light exposure for approximately 11 days after inoculation

Important Considerations:

  • Seasonal timing may affect conjugation success—early spring appears more favorable

  • Internal factors likely play a role in controlling conjugation, as the same conditions may not induce conjugation later in the season

  • Both scalariform and lateral conjugation can be observed under laboratory conditions

  • Brown coloration of zygospore walls typically develops a few days after formation

These methodologies can be useful for researchers seeking to study reproductive processes in relation to photosynthetic protein expression, including potential changes in petD expression during different life cycle stages.

Technical and Methodological Questions

  • What are the optimal protein extraction and purification methods for obtaining functional recombinant petD protein?

Extracting and purifying functional membrane proteins like petD requires specialized techniques:

Extraction Protocol:

  • Cell Lysis: Use gentle methods such as osmotic shock or enzymatic lysis to preserve protein structure

  • Membrane Isolation: Perform differential centrifugation to isolate membrane fractions

  • Solubilization: Use mild detergents like β-dodecylmaltoside (β-DM) at 1% concentration to solubilize the membrane complexes

  • Clarification: High-speed centrifugation to remove insoluble material

Purification Strategy:

  • Affinity Chromatography: Utilize His-tag for purification via Ni-NTA or similar resins

  • Size Exclusion: Further purify using size exclusion chromatography to separate monomers from dimers

  • Quality Assessment: Verify purity via SDS-PAGE (>90% purity is typically achieved)

  • Storage: Store in Tris/PBS-based buffer with 6% trehalose or 50% glycerol at pH 8.0

Critical Parameters:

  • Avoid repeated freeze-thaw cycles which can damage the protein

  • Store working aliquots at 4°C for up to one week

  • Use reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • How can researchers quantitatively assess the impact of petD mutations on electron transport rates?

Quantitative assessment of electron transport requires specific biophysical techniques:

Spectroscopic Methods:

  • Electrochromic Shift Measurements: Monitor absorbance changes at 520 nm to track the transmembrane electrogenic phase of electron transfer between hemes bL and bH

  • Oxygen Evolution: Measure oxygen production rates using Clark-type electrodes, with and without TMPD which can bypass the cytochrome b6-f complex

  • Cytochrome Redox Kinetics: Follow the oxidation/reduction kinetics of cytochrome f using difference spectroscopy

Inhibitor Studies:

  • Compare the sensitivity of wild-type and mutant complexes to specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone

  • Analyze dose-response curves to determine IC50 values and assess changes in inhibitor binding

Quantification Parameters:

  • Calculate rates relative to wild-type activity (e.g., ΔpetN showed oxygen evolution at ~30% of wild-type levels)

  • Determine electron transfer rates under various light intensities to generate light response curves

  • Assess the redox state of the plastoquinone pool to understand upstream effects

  • What differential effects do small subunit knockouts (ΔpetN, ΔpetG, ΔpetL) have on cytochrome b6-f complex assembly and function?

Small subunit knockouts have distinct effects on the cytochrome b6-f complex:

SubunitEffect on Complex AssemblyEffect on Complex FunctionSpecies-Specific Differences
ΔpetNDestabilization of complex, large subunits decreased to 20-25% of wild typeOxygen evolution reduced to ~30% of wild type, abolished state transitionsEssential in both cyanobacteria and plants
ΔpetGFaint detection of major subunits, severely reduced assemblySeverely reduced electron transferEssential in both cyanobacteria and plants
ΔpetL~50% accumulation of subunits compared to wild type, only monomeric (not dimeric) complexesImpaired photoautotrophic growth, reduced electron transferDifferent effects in different organisms - severe in Chlamydomonas, mild in Synechocystis

Key Observations:

  • PetN and PetG appear to be essential in all studied organisms

  • ΔpetL specifically prevents dimerization of the complex, resulting in only monomeric forms

  • In ΔpetL, the Rieske FeS protein shows decreased stability

  • Loss of petD subunit in tobacco prevents accumulation of other subunits of the cytochrome complex

  • ATP synthase subunit α levels are significantly up-regulated in ΔpetN and ΔpetG, but unchanged in ΔpetL

  • How can researchers design definitive experiments to establish causality between petD structure and observed functional effects?

Designing definitive experiments to establish causality requires multiple complementary approaches:

Structure-Function Analysis:

  • Site-Directed Mutagenesis: Create targeted mutations in conserved regions like the PEWY motif to assess specific functional consequences

  • Domain Swapping: Exchange domains between petD proteins from different species to identify regions responsible for specific functions

  • Truncation Analysis: Create systematic truncations to map functional domains

Complementation Studies:

  • In vivo Complementation: Transform petD knockout mutants with wild-type or mutant versions of the gene

  • Cross-Species Complementation: Test whether petD from one species can rescue mutants of another species

Advanced Structural Analysis:

  • Cryo-EM Studies: Determine high-resolution structures of wild-type and mutant complexes

  • Molecular Dynamics Simulations: Model protein dynamics and substrate interactions in silico

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Map conformational changes upon substrate binding

Controls and Validation:

  • Protein Expression Verification: Ensure mutant phenotypes are not due to expression level differences

  • Multi-Parameter Phenotyping: Assess multiple functional parameters (electron transport, complex stability, state transitions)

  • In vitro Reconstitution: Reconstitute purified components to test specific biochemical functions

  • What are the latest findings regarding the role of the cytochrome b6-f complex in state transitions and how might this impact future research?

Recent research has significantly advanced our understanding of the cytochrome b6-f complex's role in state transitions:

Key Recent Findings:

  • A 2025 study demonstrated that loss of the small subunit PetN in Anabaena variabilis abolished state transitions, providing strong evidence that the cytochrome b6-f complex is required for state transitions in cyanobacteria

  • The Qo site of the complex has been directly implicated in LHCII kinase activation through studies using the pwye mutant, which showed complete inhibition of state transitions despite normal complex assembly

  • Plastoquinol binding at the Qo pocket is required for activation of the LHCII kinase, as demonstrated by 33Pi labeling experiments showing poor phosphorylation of antenna proteins in Qo site mutants

Implications for Future Research:

  • Development of more targeted approaches to modify specific interaction surfaces between the cytochrome b6-f complex and the LHCII kinase

  • Investigation of species-specific differences in state transition mechanisms, particularly comparing algae like Spirogyra maxima with higher plants

  • Exploration of how environmental factors influence cytochrome b6-f complex-mediated state transitions

  • Design of synthetic biology approaches to engineer optimized state transition mechanisms for improved photosynthetic efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.