Recombinant Spirogyra maxima Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Spirogyra maxima Cytochrome b6 (petB)

Recombinant Spirogyra maxima Cytochrome b6 (petB) is a full-length, His-tagged protein (UniProt ID: Q71KP4) derived from the green alga Spirogyra maxima. This protein is a core component of the cytochrome b6f complex, critical for photosynthetic electron transport in oxygenic organisms. Its recombinant production in E. coli enables structural and functional studies of photosynthetic machinery across species .

Primary Structure

The protein spans 215 amino acids (1–215), with a His-tag fused at the N-terminus. Its sequence includes conserved motifs for heme binding and transmembrane helices critical for electron transfer .

Amino Acid Sequence
MGKIYDWFEERLEIQAIADDIISKYVPPHVNIFYCLGGITLTCFLIQVATGFAMTFYYRP TVAEAFASVQYIMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPIIGAPIVELLRGSVSVGQTTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Full-length sequence of Spirogyra maxima Cytochrome b6 (petB) .

Role in Photosynthetic Electron Transport

Cytochrome b6 (petB) forms part of the cytochrome b6f complex, which mediates:

  • Linear electron transfer (LET) between Photosystem II (PSII) and Photosystem I (PSI).

  • Cyclic electron transfer (CET) around PSI, which regulates ATP synthesis and redox balance .

The complex also participates in state transitions, modulating light-harvesting efficiency between PSII and PSI .

Expression Systems

Recombinant Cytochrome b6 (petB) is produced via heterologous expression in:

Expression SystemSourceTagPurity
E. coliPlasmidHis>90%
YeastPlasmidN/AN/A
BaculovirusViralN/AN/A
Mammalian cellsPlasmidN/AN/A
Data from .

Functional Insights from Mutant Studies

  1. Destabilization of the Cytochrome b6f Complex:

    • Deletion of PetN (a small subunit) in Anabaena mutants reduces cytochrome b6f stability, leading to a 70% loss of oxygen evolution activity. This highlights the role of auxiliary subunits in complex integrity .

  2. Structural Interactions with PetP:

    • Cryo-EM structures of Synechocystis cytochrome b6f reveal PetP binding to the cytoplasmic side, shielding the C-terminus of cytochrome b6. This interaction may regulate CET by modulating heme c n accessibility .

Comparative Analysis of Expression Systems

SystemAdvantagesLimitations
E. coliHigh yield, cost-effectivePotential misfolding
BaculovirusProper post-translational modificationsLower yield, higher cost
Mammalian cellsNative folding, glycosylationComplex purification
Based on .

Applications in Biotechnology

  • Photosynthetic Research: Studying LET/CET dynamics and redox regulation .

  • Genetic Engineering: Modifying petB to enhance electron transport efficiency in bioengineered organisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Spirogyra maxima (Green alga)
Target Names
petB
Target Protein Sequence
MGKIYDWFEERLEIQAIADDIISKYVPPHVNIFYCLGGITLTCFLIQVATGFAMTFYYRP TVAEAFASVQYIMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPIIGAPIVELLRGSVSVGQTTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a crucial component of the cytochrome b6-f complex. This complex plays a vital role in electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions within the photosynthetic apparatus.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of cytochrome b6 in Spirogyra species?

Cytochrome b6 is a transmembrane protein component of the cytochrome b6f complex, which plays a central role in electron transport during photosynthesis. While specific structural data for Spirogyra maxima cytochrome b6 is limited, we can infer its characteristics from related species.

The protein typically consists of approximately 215-222 amino acids with a molecular mass of approximately 25 kDa . The protein contains transmembrane helices that anchor it within the thylakoid membrane of chloroplasts. In Spirogyra, which belongs to the charophyte green algae and possesses helically arranged chloroplasts, cytochrome b6 functions similarly to other photosynthetic organisms by transferring electrons between photosystem II and photosystem I .

Unlike higher plant petB sequences but similar to some cyanobacteria, cytochrome b6 may contain an amino-terminal extension, though this varies between species. Post-translational modifications, including potential removal of amino acids from the amino terminus, have been observed in some species .

How does the petB gene structure in Spirogyra compare to other photosynthetic organisms?

The petB gene encoding cytochrome b6 shows notable variations across photosynthetic organisms:

  • In cyanobacteria such as Synechocystis sp. PCC 6803, the petB gene consists of 666 nucleotides encoding a 25.02 kDa polypeptide .

  • Unlike higher plants, which may contain introns in the petB gene, cyanobacterial petB sequences typically lack introns .

  • Some non-nitrogen-fixing unicellular cyanobacteria exhibit an amino-terminal extension of seven amino acids not found in higher plants .

  • In Spirogyra, as a charophyte green alga that represents an evolutionary lineage between green algae and land plants, the petB gene structure likely shares characteristics with both groups.

Within chloroplast genomes, the petB gene is typically located in the large single-copy (LSC) region, as observed in many photosynthetic organisms . The gene's organization and location in the genome reflect the evolutionary relationships between different photosynthetic lineages.

What expression systems are most effective for producing recombinant cytochrome b6 protein?

Based on established protocols for similar proteins, the following expression systems have proven effective for recombinant cytochrome b6:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, rapid growth, well-established protocols Potential for inclusion bodies, lack of post-translational modificationsOptimization of growth conditions and induction parameters is crucial
Yeast systemsBetter post-translational modificationsLower yield than bacterial systemsMay be preferred for functional studies requiring proper folding
Cell-free systemsAvoids toxicity issues, rapidHigher cost, lower yieldUseful for initial characterization studies

For recombinant cytochrome b6 from Spirogyra maxima, E. coli systems have been successfully employed with N-terminal His-tags to facilitate purification . When using E. coli, consider:

  • Growth at lower temperatures (16-25°C) after induction to improve protein folding

  • Optimization of induction time and inducer concentration

  • Supplementation with heme precursors to facilitate proper cofactor incorporation

  • Use of specialized E. coli strains designed for membrane protein expression

How do mutations in the petB gene affect the function of the cytochrome b6f complex in Spirogyra compared to other green algae?

Key considerations when studying petB mutations in Spirogyra:

  • Mutations affecting heme binding residues typically result in complete loss of function and are lethal unless heteroplasmic (containing both mutant and wild-type chloroplasts).

  • Mutations in transmembrane regions may affect protein stability and assembly of the cytochrome b6f complex.

  • Mutations in the stromal or lumenal loops might affect interactions with other components of the photosynthetic electron transport chain.

  • Spirogyra, with its unique helical chloroplast arrangement , may exhibit distinct phenotypic responses to petB mutations compared to other green algae with different chloroplast architectures.

When investigating mutation effects, researchers should employ multiple approaches:

What are the challenges in isolating functional recombinant cytochrome b6 and how can they be overcome?

Isolating functional recombinant cytochrome b6 presents several challenges due to its membrane-bound nature and requirement for proper cofactor incorporation. Major challenges and their solutions include:

  • Protein Solubility: Cytochrome b6 is highly hydrophobic with multiple transmembrane domains.

    • Solution: Use mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin for solubilization.

    • Method: Gradually add detergent to membrane fractions and incubate at 4°C with gentle agitation.

  • Proper Folding: Ensuring correct protein folding is essential for function.

    • Solution: Express at lower temperatures (16-20°C) and consider specialized chaperone co-expression systems.

  • Cofactor Incorporation: Cytochrome b6 requires proper heme incorporation.

    • Solution: Supplement growth media with δ-aminolevulinic acid to enhance heme biosynthesis.

  • Complex Assembly: In vivo, cytochrome b6 functions as part of a larger complex.

    • Solution: Consider co-expression with other complex components or isolation under native conditions.

  • Purification Without Denaturation: Maintaining native structure during purification.

    • Solution: Use affinity tags that allow mild elution conditions, such as His-tags with imidazole gradient elution .

A recommended purification protocol would follow these steps:

  • Cell lysis under mild conditions (osmotic shock or gentle mechanical disruption)

  • Membrane fraction isolation via differential centrifugation

  • Solubilization with appropriate detergent

  • Affinity chromatography using His-tag

  • Size exclusion chromatography to remove aggregates and isolate properly folded protein

How does the amino acid sequence of Spirogyra maxima cytochrome b6 differ from other Spirogyra species and what are the functional implications?

While specific sequence data for Spirogyra maxima cytochrome b6 is not provided in the search results, we can analyze potential sequence variations and their implications based on patterns observed in other organisms.

Cytochrome b6 sequences typically show high conservation in functional domains, particularly in:

  • Heme-binding regions (histidine residues that coordinate heme groups)

  • Transmembrane helices

  • Regions interacting with other subunits of the cytochrome b6f complex

Variable regions are more commonly found in:

  • Stromal-facing loops

  • N-terminal and C-terminal regions

  • Surface-exposed portions not critical for electron transport

The sequence variations between Spirogyra species likely reflect their evolutionary adaptations to different aquatic environments. Spirogyra species are found across various freshwater habitats with different light conditions, temperatures, and nutrient availabilities . These environmental differences may drive subtle adaptations in cytochrome b6 structure that optimize photosynthetic performance under specific conditions.

Functional implications of these sequence variations might include:

  • Differences in the thermal stability of the protein

  • Altered redox potentials affecting electron transfer rates

  • Modified interactions with other components of the photosynthetic apparatus

  • Differences in sensitivity to inhibitors or environmental stressors

For precise determination of sequence variations, researchers should conduct comparative genomic analyses of petB genes from multiple Spirogyra species, followed by functional characterization through recombinant expression and biochemical analysis.

What protocols are most effective for extracting and sequencing the petB gene from Spirogyra maxima?

Extracting and sequencing the petB gene from Spirogyra maxima requires careful consideration of the filamentous structure and robust cell walls of this freshwater alga. The following protocol outlines an effective approach:

DNA Extraction Protocol:

  • Sample Collection and Preparation:

    • Collect fresh Spirogyra maxima samples from culture or natural sources

    • Wash thoroughly with sterile water to remove epiphytes

    • Treat with brief sonication to disrupt filaments

  • Cell Lysis:

    • Use a combination of mechanical disruption (bead-beating) and enzymatic treatments (cellulase, pectinase)

    • Incubate in lysis buffer containing CTAB (cetyltrimethylammonium bromide) at 60°C for 1 hour

  • DNA Purification:

    • Extract with chloroform:isoamyl alcohol (24:1)

    • Precipitate DNA with isopropanol

    • Wash with 70% ethanol and resuspend in TE buffer

PCR Amplification of petB:

  • Primer Design:

    • Design primers based on conserved regions of petB from related Zygnematophyceae

    • Include restriction sites for subsequent cloning if needed

  • PCR Conditions:

    • Initial denaturation: 95°C for 5 minutes

    • 35 cycles of: 95°C for 30 seconds, 55-58°C for 30 seconds, 72°C for 1 minute

    • Final extension: 72°C for 10 minutes

  • Sequence Verification:

    • Clone PCR products into a suitable vector

    • Sequence using both vector-specific and internal primers

    • Analyze sequences using bioinformatics tools to confirm identity

For complete chloroplast genome sequencing, a combination of long-read (PacBio) and short-read (Illumina) sequencing technologies provides optimal results, as demonstrated in the chloroplast genome assembly of other plants .

What are the optimal conditions for expressing and purifying functional recombinant Spirogyra cytochrome b6?

Based on established protocols for similar proteins, the following conditions are recommended for expression and purification of functional recombinant Spirogyra cytochrome b6:

Expression Conditions:

ParameterOptimal ConditionRationale
Expression hostE. coli BL21(DE3) or C41(DE3)Strains optimized for membrane protein expression
Expression vectorpET series with N-terminal His-tagFacilitates detection and purification
Growth temperature20°C after inductionReduces inclusion body formation
Inducer concentration0.1-0.3 mM IPTGLower concentrations favor proper folding
Growth mediaTB or 2YT with supplementsRicher media support membrane protein expression
Induction OD6000.6-0.8Optimal cell density for induction
Post-induction time16-20 hoursExtended time for proper folding

Purification Protocol:

  • Cell Harvest and Lysis:

    • Centrifuge cultures at 4,000 × g for 20 minutes at 4°C

    • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 5% glycerol

    • Add protease inhibitors and lyse by French press or sonication

  • Membrane Fraction Isolation:

    • Centrifuge lysate at 20,000 × g for 30 minutes to remove cell debris

    • Ultracentrifuge supernatant at 100,000 × g for 1 hour to pellet membranes

    • Resuspend membrane pellet in solubilization buffer

  • Protein Solubilization:

    • Add detergent (1% DDM or 1.5% digitonin) to membrane suspension

    • Incubate with gentle agitation at 4°C for 1-2 hours

    • Centrifuge at 100,000 × g for 30 minutes to remove insoluble material

  • Affinity Purification:

    • Load solubilized protein onto Ni-NTA resin equilibrated with buffer containing 0.05% DDM

    • Wash with increasing concentrations of imidazole (20-50 mM)

    • Elute protein with 250-300 mM imidazole

  • Further Purification:

    • Perform size exclusion chromatography in buffer containing 0.05% DDM

    • Concentrate protein using 30 kDa MWCO concentrators

    • Store at -80°C in buffer containing 10% glycerol

For long-term storage, lyophilization with 6% trehalose in Tris/PBS-based buffer at pH 8.0 has been successful for similar proteins .

What spectroscopic and structural analysis methods are most informative for characterizing recombinant cytochrome b6?

Characterizing recombinant cytochrome b6 requires multiple complementary techniques to assess its structural integrity and functional properties:

1. Absorption Spectroscopy:

  • UV-visible spectroscopy to identify characteristic heme absorption peaks

  • Difference spectra between reduced and oxidized forms to confirm functional redox activity

  • Peak positions: Soret band (around 420 nm) and α/β bands (520-560 nm)

  • Changes in these spectra can indicate proper heme incorporation and protein folding

2. Circular Dichroism (CD):

  • Far-UV CD (190-250 nm) to determine secondary structure composition

  • Near-UV CD (250-320 nm) to assess tertiary structure

  • Thermal stability measurements to determine melting temperature

3. Fluorescence Spectroscopy:

  • Intrinsic tryptophan fluorescence to monitor structural changes

  • Fluorescence quenching experiments to probe accessibility of specific residues

  • Red-edge excitation shift (REES) to assess protein dynamics

4. EPR Spectroscopy:

  • Analysis of paramagnetic centers to characterize heme environment

  • Determination of g-values characteristic of low-spin and high-spin heme

  • Temperature-dependent EPR to study electronic properties

5. Structural Analysis Methods:

  • X-ray crystallography (challenging for membrane proteins)

  • Cryo-electron microscopy for structure determination without crystallization

  • NMR spectroscopy for dynamic information (limited by protein size)

6. Functional Assays:

  • Electron transfer activities using artificial electron donors/acceptors

  • Reconstitution into liposomes to measure vectorial electron transfer

  • Protein-protein interaction studies with other components of the cytochrome b6f complex

The combination of these techniques provides comprehensive characterization of the recombinant protein's structural integrity, cofactor incorporation, and functional properties.

How can recombinant Spirogyra cytochrome b6 be used to study evolutionary relationships among green algae?

Recombinant Spirogyra cytochrome b6 provides a valuable tool for studying evolutionary relationships among green algae, particularly in understanding the transition from aquatic to terrestrial environments. Spirogyra belongs to the Zygnematophyceae class, which recent phylogenomic studies suggest is closely related to land plants .

Key research applications include:

  • Comparative Sequence Analysis:

    • Alignment of cytochrome b6 sequences from diverse green algae and land plants

    • Identification of conserved and variable regions that reflect evolutionary pressures

    • Construction of phylogenetic trees to refine our understanding of charophyte green algae evolution

  • Structure-Function Comparisons:

    • Analysis of structural adaptations in cytochrome b6 across different lineages

    • Correlation of sequence variations with habitat-specific adaptations

    • Identification of signature sequences that distinguish major evolutionary lineages

  • Ancestral Sequence Reconstruction:

    • Using recombinant expression to produce and characterize ancestral forms of cytochrome b6

    • Testing hypotheses about the evolution of photosynthetic electron transport

    • Understanding how protein function evolved during the transition to land

  • Molecular Clock Analyses:

    • Using cytochrome b6 sequence divergence to estimate divergence times

    • Calibrating molecular clocks with fossil evidence

    • Refining timelines for key evolutionary transitions in the green plant lineage

Spirogyra maxima's positioning in the evolutionary tree makes its cytochrome b6 particularly valuable for understanding adaptations that preceded and facilitated plant terrestrialization, as the Zygnematophyceae represent one of the closest algal relatives to land plants .

What approaches can be used to study the interaction between cytochrome b6 and other components of the photosynthetic electron transport chain?

Understanding the interactions between cytochrome b6 and other components of the photosynthetic electron transport chain is crucial for elucidating the mechanism of photosynthetic electron flow. Several approaches can be employed:

1. Co-immunoprecipitation (Co-IP) Studies:

  • Use antibodies against recombinant His-tagged cytochrome b6 to pull down interacting partners

  • Identify binding partners using mass spectrometry

  • Verify interactions using reverse Co-IP with antibodies against putative partners

2. Surface Plasmon Resonance (SPR):

  • Immobilize purified recombinant cytochrome b6 on sensor chips

  • Measure binding kinetics with purified interaction partners

  • Determine association and dissociation constants for various interactions

3. Crosslinking Studies:

  • Use chemical crosslinkers with different spacer lengths to capture transient interactions

  • Analyze crosslinked products by mass spectrometry

  • Identify interaction interfaces through crosslink mapping

4. Reconstitution Studies:

  • Incorporate recombinant cytochrome b6 into liposomes

  • Add purified components of the electron transport chain

  • Measure electron transfer rates to assess functional interactions

5. Structural Studies of Protein Complexes:

  • Use cryo-electron microscopy to visualize cytochrome b6f complex

  • Perform single-particle analysis to determine structure at high resolution

  • Identify precise interaction interfaces and conformational changes

6. Mutational Analysis:

  • Create site-directed mutations in potential interaction interfaces

  • Express and characterize mutant proteins

  • Assess effects on complex formation and electron transport

These approaches provide complementary information about the structural and functional interactions of cytochrome b6 within the photosynthetic apparatus, advancing our understanding of photosynthetic electron transport.

What are the implications of studying Spirogyra cytochrome b6 for understanding adaptation to different environmental conditions?

Studying Spirogyra cytochrome b6 offers insights into how photosynthetic organisms adapt to various environmental conditions, particularly in freshwater ecosystems. Spirogyra species are found worldwide in diverse aquatic habitats, making them excellent models for studying environmental adaptation .

Key research implications include:

  • Temperature Adaptation:

    • Comparison of cytochrome b6 from Spirogyra species adapted to different temperature regimes

    • Analysis of structural modifications that maintain protein stability and function across temperature ranges

    • Correlation between sequence variations and optimal growth temperatures

  • Light Adaptation:

    • Investigation of how cytochrome b6 structure and function respond to varying light intensities and spectra

    • Understanding adaptations in electron transport rates under different light conditions

    • Elucidation of mechanisms that protect against photodamage during high light exposure

  • Nutrient Limitation Responses:

    • Study of how cytochrome b6 function is maintained under iron limitation (iron being essential for heme cofactors)

    • Analysis of electron transport efficiency under varying nutrient conditions

    • Identification of adaptations that maximize photosynthetic output with limited resources

  • Pollution and Stress Tolerance:

    • Investigation of cytochrome b6 modifications that confer tolerance to environmental pollutants

    • Understanding of how the protein's structure and function respond to oxidative stress

    • Development of biomarkers for aquatic ecosystem health based on cytochrome b6 modifications

  • Climate Change Implications:

    • Prediction of how cytochrome b6 function might adapt to changing global conditions

    • Understanding the limits of adaptation at the molecular level

    • Identification of vulnerable aspects of photosynthetic electron transport under future climate scenarios

These studies not only advance our fundamental understanding of photosynthetic adaptation but also have applications in biotechnology, environmental monitoring, and predicting ecosystem responses to environmental change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.