Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF1 (ORF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ORF1; Uncharacterized protein ORF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-713
Protein Length
full length protein
Species
Spiroplasma virus SpV1-C74 (SpV1)
Target Names
ORF1
Target Protein Sequence
MRKSLSLFSIFILIFLGLVIPFITLTAFRPLNEEQYTLKQESSTGKGINETDFINTMFLR SSFFENWSETNYFINPTLKTSKNLLFNDKWYLDFLQDSYSTGVVYDKPNEVFLNYYQQWH SLKNRYMVEKFYDVKKENFLNDLIDFIYAFAVKYKMFNVSKEIVKNVDRYKENHYPRVKL NQDNWKLIDDIENVDKYKWEDETYIGITKIWKNKEWNWIIEDWKLHPPFSNVYLSSYKAI YRWTGVGKPQLPTIDKNTGEITDWNSYQQTRVKEFIDLSLYSVLLENTRVQQGGSADYEN PNKVGTKRIIFDFETVDELDVKNIKKAIYRMILTVDEANLIISGSLELNNINNDDLSFNF SFMRTGMGEVFNFNGSIYSSLNSKDLKYYQQFSGQFDLSKFLQSFFASALVPVFQNRSSF IENGYIDNLQYDTVLVNFFALKLQNFNNILLSENINDKLQFDKLLNSMFKISQKFYTNYL RTIFDLENNTYVQGYNKKYGLLVNNGFKIYPRYFYFSDKYKQLDIKLYSAFKNRFYTINN YGSVFNYDFSVANNYNISLNSGYVFGGDLQNKYGLQYKKIEEQKIGYNVFELQAQKENDM YRYYDFNFGIYNWQEINNGGLFPDKQWWQVQYITPKGWWDFGAHIKNAVIWIVNTIPGVK QVNELASGVGKVFETVYSFFSQIFEVWKFNPALYSTITNIFLLIIFMKFVRLI
Uniprot No.

Target Background

Database Links

KEGG: vg:944361

Protein Families
Plectrovirus ORF1 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the optimal storage protocol for Recombinant Spiroplasma virus SpV1-C74 ORF1 protein?

For optimal stability and activity retention of the Recombinant Spiroplasma virus SpV1-C74 ORF1 protein, storage in a Tris-based buffer with 50% glycerol at -20°C is recommended for routine use. For extended storage periods, conservation at -80°C is advised to prevent protein degradation and maintain structural integrity. Working aliquots should be maintained at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing significantly compromises protein stability and functional activity .

What expression systems are most suitable for producing Recombinant SpV1-C74 ORF1 protein?

The selection of an appropriate expression system for Recombinant SpV1-C74 ORF1 protein depends on experimental goals and downstream applications. While bacterial systems offer high yields and cost-effectiveness, eukaryotic systems may provide superior post-translational modifications. Based on current methodologies for viral proteins, the following approaches are recommended:

Expression SystemAdvantagesLimitationsOptimal for
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsStructural studies, antibody production
Insect cellsBetter protein folding, moderate yieldMore complex system, higher costFunctional studies, enzyme assays
Mammalian cellsAuthentic modifications, proper foldingLower yield, highest costInteraction studies, cell-based assays

The choice of vector should incorporate appropriate purification tags that don't interfere with the protein's functional domains, as demonstrated in similar viral protein expression studies .

How can I verify the quality of purified Recombinant SpV1-C74 ORF1 protein?

Quality assessment of purified Recombinant SpV1-C74 ORF1 protein should follow a multi-method approach:

  • SDS-PAGE analysis: Evaluate purity and verify the expected molecular weight (approximately 78 kDa based on the 713 amino acid sequence).

  • Western blotting: Confirm identity using specific antibodies against the protein or incorporated tags.

  • Mass spectrometry: Validate the amino acid sequence and identify any post-translational modifications.

  • Dynamic light scattering: Assess aggregation state and homogeneity of the protein preparation.

  • Circular dichroism: Evaluate secondary structure integrity to ensure proper folding.

For functional verification, development of specific activity assays would be necessary, though challenging due to the uncharacterized nature of the protein .

What experimental approaches are most effective for determining the function of Uncharacterized ORF1 protein in SpV1-C74 viral lifecycle?

Determining the function of the Uncharacterized ORF1 protein requires a comprehensive multi-omics approach:

  • Structural Biology Techniques:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • NMR spectroscopy for dynamic regions analysis

    • In silico structural prediction followed by experimental validation

  • Interaction Studies:

    • Yeast two-hybrid screening against Spiroplasma host proteins

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity-dependent biotinylation (BioID) in cellular models

  • Functional Genomics:

    • CRISPR interference in expression systems

    • Site-directed mutagenesis of conserved domains

    • Complementation assays in viral infection models

  • Comparative Analysis:

    • Alignment with functionally characterized proteins in related viruses

    • Phylogenetic analysis to identify evolutionary conservation patterns

When implementing these approaches, it's critical to establish appropriate controls and validation steps to confidently assign function. The amino acid sequence analysis reveals potential transmembrane domains, suggesting a possible membrane-associated function that should be prioritized in experimental design .

How can I design a quasi-experimental approach to study the impact of SpV1-C74 ORF1 expression on Spiroplasma host cells?

When ethical or practical constraints prevent randomized controlled trials in Spiroplasma systems, a well-designed quasi-experimental approach can provide valuable insights into ORF1's impact on host cells:

  • Nonequivalent Groups Design:

    • Compare naturally infected Spiroplasma populations with varying ORF1 expression levels

    • Control for confounding variables through statistical matching techniques

    • Implement propensity score matching to balance observed covariates

  • Regression Discontinuity Design:

    • Exploit natural thresholds in ORF1 expression to create comparison groups

    • Analyze host phenotypes immediately above and below expression thresholds

    • Employ local regression techniques to estimate treatment effects at the threshold

  • Interrupted Time Series Analysis:

    • Monitor host populations before and after controlled ORF1 induction

    • Implement segmented regression to quantify changes in trends

    • Control for seasonal or cyclical variations in Spiroplasma populations

When implementing quasi-experimental designs, it's essential to explicitly acknowledge limitations in internal validity while maximizing external validity through careful selection of study populations and comprehensive documentation of experimental conditions .

What are the methodological considerations for developing a recombinant vector system using SpV1-C74 ORF1 for heterologous protein expression?

Developing a recombinant vector system using SpV1-C74 ORF1 requires careful consideration of several methodological aspects:

  • Vector Design Strategy:

    • Identify and preserve essential regulatory elements within the ORF1 sequence

    • Engineer appropriate restriction sites for cloning without disrupting functional domains

    • Incorporate selection markers compatible with target expression systems

  • Insertion Site Selection:

    • Analyze the complete 713 amino acid sequence to identify non-essential regions

    • Perform domain prediction to avoid disrupting potential functional elements

    • Consider using linker sequences to minimize structural interference

  • Expression Optimization:

    • Codon optimization for the target expression system

    • Incorporation of signal sequences for proper localization

    • Design of inducible promoters to control expression levels

  • Validation Approach:

    • Western blotting to confirm fusion protein expression

    • Functional assays to ensure retained activity of both ORF1 and the heterologous protein

    • Growth curve analysis to assess impact on host cell viability

Learning from similar approaches with other viral vectors, transfection protocols should be optimized specifically for the target cells, with special attention to transfection efficiency and potential cytotoxicity of the recombinant constructs .

How should I design control experiments when studying recombinant SpV1-C74 ORF1 interactions with host cellular components?

Designing rigorous controls is essential for reliable interpretation of SpV1-C74 ORF1 interaction studies:

  • Negative Controls:

    • Empty vector controls expressing tag-only constructs

    • Unrelated viral protein from similar size/structure

    • Heat-denatured ORF1 protein to control for non-specific binding

    • Mock-transfected/treated cells to establish baseline measurements

  • Positive Controls:

    • Known protein-protein interactions in the same experimental system

    • Validated antibody-antigen pairs for immunoprecipitation studies

    • Well-characterized protein domains with established interaction partners

  • Validation Controls:

    • Reciprocal co-immunoprecipitation with differently tagged constructs

    • Competition assays with unlabeled protein

    • Dose-response experiments to demonstrate specificity

  • System Controls:

    • Multiple cell types to control for cell-specific effects

    • Time-course experiments to distinguish transient from stable interactions

    • Subcellular fractionation to confirm compartment-specific interactions

Implementation of these controls should follow a systematic approach, with each experiment including the full suite of controls and replication across independent biological samples to enable statistical analysis of interaction significance .

What analytical techniques are most appropriate for resolving contradictory data regarding SpV1-C74 ORF1 function?

When faced with contradictory results regarding SpV1-C74 ORF1 function, implement a systematic analytical approach:

  • Methodological Reconciliation:

    • Cross-validate findings using orthogonal techniques

    • Standardize experimental conditions across laboratories

    • Implement blinded analysis to minimize confirmation bias

  • Statistical Approaches:

    • Meta-analysis of aggregated datasets

    • Bayesian modeling to incorporate prior knowledge

    • Sensitivity analysis to identify sources of variability

  • Technical Considerations:

    • Evaluate antibody specificity through knockout/knockdown controls

    • Assess protein tag interference with comprehensive tag placement studies

    • Consider post-translational modifications that might affect function

  • Biological Context Analysis:

    • Examine host cell type-specific effects

    • Consider temporal dynamics of protein expression and modification

    • Evaluate microenvironmental factors affecting protein activity

When publishing results, transparently report all experimental conditions, raw data availability, and limitations to facilitate reproducibility and collaborative resolution of contradictions .

How can I identify potential post-translational modifications of Recombinant SpV1-C74 ORF1 and their functional significance?

A comprehensive workflow for identifying post-translational modifications (PTMs) of Recombinant SpV1-C74 ORF1 should include:

  • Prediction and Screening:

    • In silico prediction of potential modification sites using algorithms specific for each PTM type

    • Conservation analysis of predicted sites across related viral proteins

    • Enrichment strategies for specific modifications (e.g., phospho-enrichment)

  • Analytical Detection:

    • High-resolution mass spectrometry with multiple fragmentation techniques

    • Site-specific antibodies for common modifications

    • Specialized gel staining methods (e.g., Pro-Q Diamond for phosphorylation)

  • Functional Validation:

    • Site-directed mutagenesis of modified residues

    • Temporal correlation of modifications with protein activity

    • Inhibitor studies targeting specific modifying enzymes

  • Quantitative Assessment:

    • SILAC or TMT labeling for quantitative PTM profiling

    • Parallel reaction monitoring for targeted quantification

    • Estimation of modification stoichiometry at specific sites

The complete ORF1 sequence analysis reveals numerous potential modification sites, including 35 serine residues, 27 threonine residues, and 15 tyrosine residues that could be phosphorylated, as well as multiple lysine residues that could undergo acetylation, methylation, or ubiquitination .

What are the optimal approaches for studying potential interactions between SpV1-C74 ORF1 and host cell membranes?

Based on sequence analysis suggesting membrane association properties, investigating ORF1-membrane interactions requires specialized techniques:

  • Membrane Localization Studies:

    • Fluorescence microscopy with tagged ORF1 constructs

    • Subcellular fractionation followed by Western blotting

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

  • Membrane Binding Characterization:

    • Liposome binding assays with varying lipid compositions

    • Surface plasmon resonance for quantitative binding kinetics

    • Monolayer penetration measurements for insertion depth determination

  • Structural Analysis at Membranes:

    • Solid-state NMR of reconstituted protein-membrane systems

    • ATR-FTIR spectroscopy to determine secondary structure at interfaces

    • Molecular dynamics simulations of membrane interactions

  • Functional Membrane Assays:

    • Patch clamp for potential channel formation

    • Membrane permeabilization assays using fluorescent dyes

    • Lipid mixing assays to detect membrane fusion activity

The predicted transmembrane regions within the ORF1 sequence, particularly in the N-terminal portion (amino acids 1-40), suggest potential roles in membrane anchoring or modification that should guide experimental design .

What methodologies are most effective for investigating the role of SpV1-C74 ORF1 in Spiroplasma genome evolution?

To investigate the evolutionary impact of SpV1-C74 ORF1 on Spiroplasma genomes, implement these methodological approaches:

  • Comparative Genomics:

    • Whole genome sequencing of Spiroplasma strains with and without integrated SpV1

    • Analysis of insertion sites and genomic rearrangements

    • Assessment of copy number variation across strains

  • Molecular Evolution Analysis:

    • Selection pressure analysis (dN/dS ratios) on ORF1 and flanking regions

    • Identification of recombination events using phylogenetic methods

    • Molecular clock analysis to date integration events

  • Functional Impact Assessment:

    • Transcriptome analysis of host genes near integration sites

    • CRISPR-based excision to evaluate phenotypic effects

    • Heterologous expression to test for potential domestication

  • Population Genetics Approaches:

    • Sampling across geographic regions to assess distribution

    • Analysis of horizontal gene transfer frequency

    • Metagenomic analysis to identify novel variants

The analysis of SpV1 integration patterns reveals significant genome rearrangements in S. citri strains, suggesting that viral integration represents a major evolutionary force. The methodology should focus on identifying whether ORF1 provides selective advantages to hosts harboring integrated viral sequences .

How can I design experiments to test the immunogenicity of SpV1-C74 ORF1 in comparative immunology models?

When studying the immunogenic properties of SpV1-C74 ORF1, consider these methodological approaches:

  • Animal Model Selection and Design:

    • Small animal models (mice) for preliminary immunogenicity screening

    • Natural host or closely related models for physiologically relevant responses

    • Prime-boost strategies with varied adjuvant formulations

  • Immune Response Characterization:

    • Antibody profiling using ELISA, neutralization assays, and epitope mapping

    • T-cell response evaluation through ELISpot, flow cytometry, and proliferation assays

    • Cytokine profiling to characterize Th1/Th2/Th17 polarization

  • Comparative Assessment Framework:

    • Cross-species comparison of immune recognition patterns

    • Evaluation of cross-reactivity with related viral proteins

    • Analysis of immunodominant regions across different host species

  • Functional Immune Analysis:

    • Challenge studies to assess protective capacity

    • Adoptive transfer experiments to determine protective components

    • B and T cell receptor repertoire analysis following immunization

Drawing from similar studies with viral proteins, the experimental design should include appropriate controls for adjuvant effects and carefully monitor both humoral and cell-mediated responses to comprehensively characterize the immunological profile of ORF1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.