Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF2 (ORF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF2; Uncharacterized protein ORF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Spiroplasma virus SpV1-C74 (SpV1)
Target Names
ORF2
Target Protein Sequence
MKKFIFFFKNYCYISGSMLLFSLIDLLLWIISLYCVGLVFWILFALQCVYFVWWLWKNIF YQLNAFRLVNFVWDNPLSVIIGKLGTGKTLLLTYLSQTMKLLTDEIYSNYPLEDDKVKVL TFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKKVHSGKIPWIVLARHFRHRAL FTAQREGMIWNNIRQLASGIIIPISLKKPVAKKGFNFFNRFFIMRMGIFQDITDYEIWKT KSVERTAEGKRAKHKSDVGLGIRFFKIIIPLEFANKYDSEWLKFVRDLKNDEIVNEKFYY WSEITKLSVKERLELFDIDILKKNLKPRKEKGNGKDD
Uniprot No.

Target Background

Database Links

KEGG: vg:944350

Protein Families
Plectrovirus ORF2 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the Spiroplasma citri virus SpV1 and how does it function as a cloning vector?

Spiroplasma citri virus SpV1 has been developed as a vector system based on its replicative form (RF). The viral RF provides a foundation for expressing heterologous proteins in S. citri, as demonstrated in previous research where it was used to express an epitope of the P1 adhesin protein from Mycoplasma pneumoniae. The vector system functions through transformation of the host S. citri cells, with the recombinant RF maintained as a circular extrachromosomal element . This system is particularly valuable for expressing proteins in mollicute hosts, as traditional plasmid vectors are often limited in these organisms.

What structural features characterize the ORF2 protein in Spiroplasma virus vectors?

The ORF2 protein contains several key structural domains that influence its function and localization. Based on analysis of related viral capsid proteins, these likely include signal peptide (SP) sequences at the N-terminus that direct initial protein trafficking, and potentially arginine-rich motifs (ARM) that may regulate nuclear localization and other functions. The protein likely also contains hydrophobic regions that could function as nuclear export signals (NES), allowing for regulated movement between cellular compartments . Complete structural characterization would require experimental approaches including protein crystallography or cryo-EM to determine the three-dimensional structure.

How stable are recombinant constructs using the SpV1 vector system?

Recombinant constructs using the SpV1 vector system demonstrate notable structural instability that can lead to the loss of inserted DNA sequences. Analysis of deletion events has revealed two primary mechanisms: both illegitimate recombination (non-homologous) and homologous recombination between viral sequences. In one documented case, deletions occurred via double crossing-over exchange between the circular free viral RF and SpV1 viral sequences present in the S. citri host chromosome . This instability represents a significant challenge for long-term expression studies and must be accounted for in experimental design.

What methods are most effective for expressing and purifying the ORF2 protein?

For effective expression and purification of the ORF2 protein, a multistep approach is recommended. Begin with optimizing the expression system by selecting an appropriate S. citri strain (noting that the R8A2 strain has a partial deletion in the recA gene, which may affect recombination dynamics) . Expression should incorporate the native viral promoter elements while ensuring the reading frame is preserved. For purification, a combination of affinity chromatography (using engineered tags like His6 or FLAG) followed by size exclusion chromatography has proven effective for related viral proteins. The purification protocol must account for protein solubility and folding characteristics, which may require optimization of buffer conditions and detergent concentrations if membrane association is observed.

How can researchers assess the subcellular localization of ORF2 protein?

To assess subcellular localization of the ORF2 protein, researchers should employ multiple complementary techniques. Immunofluorescence microscopy using specific antibodies against ORF2 can provide visual evidence of localization patterns. This should be complemented with subcellular fractionation followed by Western blot analysis to quantitatively assess protein distribution among nuclear, cytoplasmic, and membrane fractions . For more definitive localization studies, researchers can create fusion constructs with fluorescent proteins (such as GFP), though care must be taken to ensure the tag doesn't disrupt normal protein trafficking. Co-localization studies with markers for specific organelles (nucleus, ER, Golgi) can further refine understanding of the protein's subcellular distribution.

What functional motifs regulate ORF2 protein trafficking between cellular compartments?

The trafficking of ORF2 between cellular compartments is likely regulated by multiple functional motifs. Signal peptide (SP) sequences direct entry into the secretory pathway, while arginine-rich motifs (ARM) can function as nuclear localization signals (NLS) . Analysis of related viral proteins suggests that hydrophobic leucine-rich regions may serve as nuclear export signals (NES) recognized by the nuclear export receptor CRM1. The interplay between these motifs creates a dynamic equilibrium of protein distribution. For example, in analogous systems, mutations that strengthen the NLS function of ARM regions increase nuclear localization but may inhibit secretion pathway functionality. Researchers investigating ORF2 trafficking should examine:

Motif TypeTypical Sequence FeaturesFunctionExperimental Approach
Signal Peptide (SP)Hydrophobic amino acidsReticular translocationSP deletion mutants
Arginine-Rich Motif (ARM)Multiple arginine residuesNuclear localizationAlanine substitutions
Nuclear Export Signal (NES)Leucine-rich hydrophobic regionsNuclear exportPoint mutations, CRM1 inhibitors

How can post-translational modifications affect ORF2 protein function?

Post-translational modifications likely play crucial roles in regulating ORF2 protein function. Based on studies of related viral capsid proteins, these modifications may include phosphorylation, glycosylation, and proteolytic processing. The presence of arginine-rich motifs and other recognizable sequence patterns suggests potential sites for modification by cellular enzymes . Proteolytic processing by cellular proteases (such as furin or related proprotein convertases) may be particularly important for maturation of the protein, especially if it contains multibasic motifs (R/K-Xn-R/K). Modifications can regulate protein localization, interaction capabilities, and assembly into higher-order structures. Researchers should investigate these modifications using mass spectrometry, specific inhibitors of modification enzymes, and site-directed mutagenesis of potential modification sites.

What strategies can overcome recombination-mediated instability in the SpV1 vector system?

To overcome recombination-mediated instability in the SpV1 vector system, researchers should implement multiple strategic approaches. First, minimize sequence homology between the vector and host genome by using codon-optimized sequences that reduce direct repeat regions. Second, engineer recombination-deficient host strains by further modifying recombination pathway components beyond the naturally RecA-deficient R8A2 strain . Third, incorporate genetic stability elements such as terminators or insulator sequences that can reduce recombination frequency. Fourth, develop selection systems that continuously select for the presence of the insert. The table below summarizes these approaches and their experimental implementation:

StrategyImplementation MethodExpected ImpactLimitations
Minimizing homologyCodon optimization of insertReduced homologous recombinationMay affect expression levels
Host strain engineeringCRISPR-based knockout of RecT or other recombination factorsReduced recombination frequencyMay affect host fitness
Stability elementsAddition of transcriptional terminators or insulatorsReduced illegitimate recombinationIncreases vector size
Continuous selectionDual selection markers or toxin-antitoxin systemsMaintains insert presenceMetabolic burden on host

How can chimeric constructs be designed to study ORF2 domain functions?

Designing chimeric constructs is a powerful approach to dissect ORF2 domain functions. Researchers should create fusion proteins that exchange specific domains between ORF2 and well-characterized reporter proteins like CD4 glycoprotein . A systematic approach would include:

  • Swapping signal peptides to assess trafficking efficiency

  • Exchanging ARM regions to evaluate nuclear localization capabilities

  • Creating truncation series to identify minimal functional domains

  • Introducing point mutations in conserved motifs to assess specific amino acid contributions

When analyzing chimeric constructs, multiple readouts should be employed including subcellular localization (by immunofluorescence), protein expression/stability (by Western blot), and functional assays specific to the domains being studied. A comprehensive experimental design would incorporate controls for protein folding using conformation-specific antibodies to ensure observed phenotypes aren't simply due to protein misfolding.

What advanced techniques can resolve contradictory data about ORF2 function?

When faced with contradictory data about ORF2 function, researchers should employ multiple advanced techniques to resolve discrepancies. Single-molecule approaches such as FRET or super-resolution microscopy can provide insights into protein dynamics that bulk measurements might miss. Cryo-electron microscopy can reveal structural details that explain functional differences. Hydrogen-deuterium exchange mass spectrometry can identify conformational changes under different conditions . Complementary genetic approaches using CRISPR-based knockouts of suspected interaction partners can validate biochemical findings. Time-resolved studies examining protein behavior across different time scales may reveal that seemingly contradictory functions occur sequentially. Finally, computational modeling integrating diverse experimental datasets can sometimes reconcile apparently conflicting observations by identifying hidden variables or complex interdependencies.

Why might ORF2 protein expression levels be low, and how can this be improved?

Low expression levels of ORF2 protein could stem from multiple factors including codon usage bias, mRNA secondary structure affecting translation initiation, protein instability, or toxicity to the host. To improve expression, researchers should first analyze the coding sequence for rare codons in the host organism and optimize accordingly. The unusual feature of Spiroplasma citri using UGA as a tryptophan codon (rather than a stop codon) is particularly important to consider when designing expression systems .

How can researchers troubleshoot nuclear versus cytoplasmic localization discrepancies?

When confronting discrepancies in nuclear versus cytoplasmic localization of ORF2, researchers should implement a systematic troubleshooting approach. First, verify antibody specificity through appropriate controls including peptide competition assays and testing in cells lacking the target protein. Second, examine fixation artifacts by comparing different fixation methods (paraformaldehyde, methanol, etc.) as these can significantly affect apparent protein localization . Third, perform time-course studies to determine if localization changes dynamically over time or in response to cellular conditions. Fourth, analyze the influence of cell cycle stage on protein distribution using synchronized cell populations. Fifth, examine cell type-specific effects by testing localization in multiple cell lines. Finally, use complementary approaches such as biochemical fractionation followed by Western blotting to quantitatively assess distribution between compartments, which can validate or challenge immunofluorescence findings.

What approaches can resolve difficulties in distinguishing between different ORF2 protein forms?

Distinguishing between different forms of the ORF2 protein presents significant challenges that require specialized approaches. Developing form-specific antibodies that recognize unique epitopes exposed in different conformations or processing states is the gold standard . These can be generated by immunizing with synthetic peptides corresponding to form-specific regions or by using recombinant protein fragments.

Two-dimensional gel electrophoresis combined with Western blotting can separate protein forms based on both molecular weight and isoelectric point, revealing modifications that might not be apparent in standard SDS-PAGE. Mass spectrometry analysis following immunoprecipitation with general anti-ORF2 antibodies can identify specific post-translational modifications and processing events. For forms differing in subcellular localization, compartment-specific isolation followed by proteomic analysis can identify location-specific variants. Finally, pulse-chase experiments using metabolic labeling can track the kinetic relationship between different forms, revealing precursor-product relationships and the temporal sequence of processing events.

How might CRISPR-Cas technology be applied to study ORF2 function?

CRISPR-Cas technology offers revolutionary approaches for studying ORF2 function. For endogenous gene modification, CRISPR-Cas9 can introduce precise mutations or tags into the ORF2 coding sequence within the viral genome, allowing observation of phenotypic effects in the native context. Knockout studies of host factors potentially interacting with ORF2 can identify essential cellular machinery required for protein function. CRISPR activation (CRISPRa) or interference (CRISPRi) systems can modulate ORF2 expression levels without permanent genetic modifications, enabling dose-dependent functional studies. CRISPR-based screens targeting potential host interaction partners can systematically identify cellular factors involved in ORF2 trafficking, modification, or function. For structural studies, CRISPR can facilitate the generation of domain deletion or substitution libraries to map functional regions at high resolution.

What are the implications of ORF2 structural studies for developing improved viral vectors?

Structural studies of ORF2 have significant implications for developing improved viral vectors. Understanding the three-dimensional conformation and critical functional domains of ORF2 can guide rational design of stabilized vector systems with reduced recombination potential . Identifying regions tolerant to modification provides opportunities for inserting heterologous sequences without disrupting essential viral functions. Characterizing protein-protein interaction interfaces might enable the engineering of vectors with altered host range or tissue tropism. Structural insights into assembly mechanisms could inform strategies to enhance packaging efficiency or cargo capacity. Additionally, understanding the atomic details of immunogenic epitopes could enable the design of vectors with reduced immunogenicity for applications requiring long-term expression.

How might systems biology approaches integrate disparate data about ORF2 function?

Systems biology approaches offer powerful frameworks for integrating disparate data about ORF2 function. Network analysis incorporating protein-protein interaction data, genetic dependencies, and co-expression patterns can position ORF2 within broader cellular pathways. Multi-omics integration combining transcriptomic, proteomic, and metabolomic responses to ORF2 expression can reveal diverse cellular impacts beyond direct interaction partners . Mathematical modeling of ORF2 trafficking kinetics can reconcile apparently contradictory localization data by accounting for dynamic equilibria between compartments. Machine learning approaches applied to large datasets can identify subtle patterns and relationships not apparent through traditional analysis. Agent-based modeling simulating individual ORF2 molecules in a virtual cellular environment can test mechanistic hypotheses and predict emergent behaviors from known molecular properties. These computational approaches can generate testable hypotheses to guide future experimental work, creating a virtuous cycle of prediction and validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.