Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF5 (ORF5)
Description
Introduction to Recombinant Spiroplasma Virus SpV1-C74 Uncharacterized Protein ORF5 (ORF5)
The Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF5 (ORF5) is a genetically engineered protein derived from the Spiroplasma virus SpV1-C74. This protein is expressed in host organisms such as Escherichia coli and is used in various research applications, including protein interaction studies and structural biology. The ORF5 protein is part of the viral genome and has been studied for its role in viral replication and interaction with host cells.
Characteristics of Recombinant Spiroplasma Virus SpV1-C74 Uncharacterized Protein ORF5 (ORF5)
-
Protein Length and Sequence: The full-length ORF5 protein consists of 135 amino acids. Its sequence is characterized by the following amino acid sequence: MVKMINLLVVENNNSNWDKIFSFVFDIFLFIFDVIWNTKLPMTNTSIAYFLVFFMVIKLS IYAIHGTSTQYNNLGSTVNNGVSQVYSSTVRKGINVGKNVYQNSNKQQVKKELKRQSIRY QAKNIRSTKFKGDKK .
-
Expression System: This protein is typically expressed in E. coli, allowing for efficient production and purification .
-
Tagging: The protein is often fused with an N-terminal His tag to facilitate purification using affinity chromatography .
-
Purity and Storage: The protein is available in high purity (>90%) and is stored as a lyophilized powder. It should be stored at -20°C or -80°C to maintain stability .
Research Findings and Applications
-
Genome Evolution: Spiroplasma viruses like SpV1-C74 play a significant role in the evolution of Spiroplasma genomes through integration and recombination events. These viruses can insert into host genes, leading to gene disruption and genomic rearrangements .
-
Recombination Mechanisms: Studies have shown that both homologous and illegitimate recombination are involved in the structural instability of viral clones, affecting the integrity of viral sequences within host genomes .
-
Protein Function: While the specific function of the ORF5 protein remains uncharacterized, recombinant proteins like ORF5 are crucial for studying protein interactions, viral replication mechanisms, and potential applications in biotechnology.
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
If you require a specific tag type, please inform us, and we will prioritize its development.
Target Background
KEGG: vg:944355
