Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF7 (ORF7)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence

The recombinant ORF7 protein spans residues 1–83, with the following sequence:
mLGMYLTTAFNFLTAPTPKTMTEGMTGIWTGLTSALWKVKEGITNIFPEIMVFLGEAWII LIPFAIFCIIKILNFFRVMVKGF .

Sequence FeatureDetail
Length83 amino acids
Molecular WeightNot explicitly stated in sources; inferred from sequence length (~9 kDa)
Key MotifsHydrophobic regions (e.g., LIPFAIFCII)
Uniprot IdentifierQ88422

Recombinant Expression

ORF7 is produced via heterologous expression in E. coli. Key production parameters include:

ParameterDetail
Host SystemE. coli
Purification MethodNot specified (likely chromatography-based)
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C (long-term); 4°C for short-term aliquots

Comparative Genomic Analysis

While SpV1-C74’s ORF7 remains uncharacterized, insights can be drawn from analogous ORFs in related viruses:

VirusORF FunctionRelevance to ORF7
SpV4 (ORF1)Capsid protein (VP1; ~62 kDa) Structural role in virion assembly
SpV4 (ORF2)Replication protein (homologous to phiX174 protein A) Potential involvement in DNA replication
VZV (ORF7)Antiviral target for siRNA therapy Hypothetical role in viral pathogenesis

Functional Speculation

ORF7’s sequence lacks homology to well-characterized viral proteins, but its hydrophobic regions suggest possible membrane interaction. Potential roles include:

  • Accessory protein: Modulating host-virus interactions.

  • Regulatory factor: Influencing viral gene expression or replication.

Knowledge Gaps

  • Functional studies: No direct evidence links ORF7 to viral processes.

  • Structural data: Lack of crystallographic or cryo-EM structures.

Proposed Research Avenues

  1. Biochemical assays: Enzyme activity screening (e.g., protease, kinase).

  2. In silico modeling: Predicting interactions with host or viral proteins.

  3. Knockout studies: Assessing viral fitness in ORF7-deleted mutants.

References and Data Sources

Source TypeContentCitation
Commercial DatasheetsAA sequence, production specs (CUSABIO, Colorectal Research)
Peer-Reviewed ArticlesGenomic organization of SpV4
Antiviral StudiesORF7 targeting in VZV (unrelated species)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
ORF7; Uncharacterized protein ORF7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-83
Protein Length
full length protein
Species
Spiroplasma virus SpV1-C74 (SpV1)
Target Names
ORF7
Target Protein Sequence
MLGMYLTTAFNFLTAPTPKTMTEGMTGIWTGLTSALWKVKEGITNIFPEIMVFLGEAWII LIPFAIFCIIKILNFFRVMVKGF
Uniprot No.

Target Background

Database Links

KEGG: vg:944356

Protein Families
Plectrovirus ORF7 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What are the recommended PCR conditions for amplifying the ORF7 region from Spiroplasma virus?

For efficient amplification of the ORF7 region, researchers should establish a PCR protocol utilizing a reaction volume of 25 μL comprising 2.5 μL 10× PCR buffer, 0.125 μL Taq polymerase, 2 μL dNTPs (10 mmol each), 1 μL each of forward and reverse primers (10 μM), 1 μL extracted viral DNA, and 18.4 μL ddH₂O. The optimal cycling conditions typically include initial denaturation at 95°C for 3 min, followed by 35 cycles of denaturation at 95°C for 30 s, annealing at 57°C for 40 s, and extension at 72°C for 40 s, with a final extension step at 72°C for 5 min . When designing primers, it's crucial to target conserved regions flanking the ORF7 gene to ensure complete amplification of the coding sequence.

How can I determine if multiple variants of ORF7 are present in my viral samples?

Multiple ORF7 variants can be detected through direct sequencing of PCR products. The appearance of multiple peaks in the chromatogram during initial sequencing indicates the presence of multiple variants . For a more comprehensive analysis, purify the PCR products using a DNA gel extraction kit, ligate them into an appropriate vector, and isolate 10-20 independent positive colonies for separate sequencing. This cloning-based approach allows for the identification of distinct ORF7 variants that may coexist within a single sample. Next-generation sequencing approaches can also detect variants with high sensitivity, even when they exist as minor populations with frequencies as low as 10% .

What is the significance of ORF7 conservation across different viral species?

The conservation of ORF7 across different viral species suggests its functional importance in viral biology. In many viruses, such as PRRSV, the ORF7 region is highly conserved, making it an ideal target for diagnostic assays and epidemiological monitoring . The conservation pattern can provide insights into selective pressures acting on the protein and its critical functional domains. When studying a previously uncharacterized ORF7 protein like that in Spiroplasma virus SpV1-C74, alignment with ORF7 sequences from related viruses can help identify conserved motifs that might indicate functional regions worthy of targeted investigation.

How can I detect and analyze intragenic recombination events within the ORF7 gene?

To detect intragenic recombination events within ORF7, utilize specialized software packages such as RDP5 that incorporate multiple detection methods. Your analysis should include at least three different detection algorithms (e.g., 3Seq, BootScan, GENECONV, and MaxChi) to ensure robust identification of recombination events . Focus on identifying breakpoints where recombination may have occurred and the potential parent sequences involved in these events.

For meaningful recombination analysis, you should:

  • Obtain multiple ORF7 sequences from your viral samples through cloning and sequencing

  • Align these sequences using a reliable multiple sequence alignment tool

  • Run recombination detection analysis using RDP5 or similar software

  • Consider only recombination events detected by multiple methods with significant p-values (typically <0.05)

  • Visualize the recombination events to identify patterns in breakpoint locations

Recombination analysis can reveal how genetic exchange between viral variants contributes to ORF7 diversity and potentially impacts viral fitness or host adaptation .

What approaches can be used to functionally characterize the uncharacterized ORF7 protein?

For functional characterization of an uncharacterized ORF7 protein, employ a multifaceted approach combining computational predictions with experimental validation:

  • Computational analysis:

    • Predict protein structure using homology modeling or ab initio approaches

    • Identify functional domains through comparison with characterized ORF7 proteins

    • Predict subcellular localization and potential interaction partners

  • Expression and purification:

    • Clone the ORF7 gene into an expression vector with a suitable tag

    • Express the protein in prokaryotic (E. coli) or eukaryotic systems

    • Purify using affinity chromatography for downstream analyses

  • Functional assays:

    • Assess protein-protein interactions through co-immunoprecipitation or yeast two-hybrid assays

    • Determine if ORF7 binds nucleic acids through electrophoretic mobility shift assays

    • Investigate potential roles in viral assembly through electron microscopy of viral particles in systems with wildtype versus mutated ORF7

  • In vivo studies:

    • Generate ORF7 knockouts or mutants to observe effects on viral replication and structure

    • Study host response to recombinant ORF7 protein to identify potential immunological roles

This comprehensive approach can help elucidate the function of previously uncharacterized viral proteins like ORF7 in Spiroplasma virus SpV1-C74.

How does next-generation sequencing enhance our understanding of ORF7 microevolution within viral populations?

Next-generation sequencing (NGS) provides unprecedented insights into ORF7 microevolution by revealing single nucleotide variants (SNVs) present at low frequencies within viral populations. To effectively utilize NGS for studying ORF7 microevolution:

  • Develop a target-specific amplicon library preparation protocol for the ORF7 region using a two-step PCR procedure with tailed primers compatible with your sequencing platform

  • Apply deep sequencing to identify minor variants and polymorphic sites, even when they exist at frequencies as low as 10%

  • Map the sequencing reads against reference sequences to identify consensus sequences for predominant variants

  • Conduct SNV analysis to identify positions with frequent variations, which might indicate sites under selection or functional importance

NGS analysis of clinical samples has revealed numerous polymorphic sites along the ORF7 gene, with some positions (e.g., 12, 165, 219, 225, 315, 345, and 351 in PRRSV) showing common variation across multiple samples . Similar analysis of Spiroplasma virus ORF7 could identify hotspots of microevolution that might contribute to viral adaptation.

Protocol for ORF7 amplification and sequencing

When amplifying and sequencing the ORF7 region from viral samples, follow this detailed protocol:

  • DNA extraction:

    • Extract viral DNA using a commercial kit suitable for your sample type

    • Quantify DNA concentration and assess quality by spectrophotometry

  • PCR amplification:

    • Prepare PCR reaction mix as described in Question 1.1

    • Run PCR using optimized cycling conditions

    • Verify amplification by gel electrophoresis (expect a band corresponding to your target ORF7 size)

  • Purification and direct sequencing:

    • Purify PCR products using a commercial kit (e.g., TaKaRa MiniBEST Agarose Gel DNA Extraction Kit)

    • Perform direct sequencing using PCR primers

    • Examine chromatograms for multiple peaks indicating variant presence

  • Cloning (for multiple variants):

    • Ligate purified PCR products into a suitable vector

    • Transform competent cells and select 10-20 positive colonies

    • Culture in LB medium with appropriate antibiotics

    • Extract plasmids using a miniprep kit

    • Sequence plasmids using vector-specific primers (e.g., M13F/R)

    • Analyze sequences to identify distinct ORF7 variants

This comprehensive approach allows for thorough characterization of ORF7 variants present in your samples, providing the foundation for subsequent phylogenetic and functional analyses.

Analysis of recombination events within ORF7

Recombination within ORF7 can be systematically analyzed following this methodology:

  • Sequence alignment:

    • Align all ORF7 sequences obtained from your samples

    • Include reference sequences if available

    • Use software like MUSCLE or MAFFT for accurate alignment

  • Recombination detection:

    • Analyze aligned sequences using RDP5 software

    • Apply multiple detection methods (3Seq, BootScan, GENECONV, MaxChi)

    • Consider recombination events detected by at least three methods

    • Record breakpoints, potential parent sequences, and statistical significance

  • Interpretation of results:

    • Identify recombination patterns (breakpoint hotspots)

    • Determine if recombination occurs between specific ORF7 lineages

    • Assess whether recombinant types persist in the population

RecombinantMajor parentMinor parentBreakpointDetection MethodsP-value range
Type AParent 1Parent 21803Seq, BootScan, GENECONV10^-4 - 10^-7
Type BParent 3Parent 12633Seq, BootScan, MaxChi10^-5 - 10^-8
Type CParent 2Parents 3, 41173Seq, BootScan, GENECONV, MaxChi10^-6 - 10^-9

This table format, adapted from similar analyses , provides a clear documentation of recombination events, facilitating comparison across different viral strains or experimental conditions.

NGS-based approach for studying ORF7 diversity and microevolution

For comprehensive analysis of ORF7 diversity using next-generation sequencing:

  • Library preparation:

    • Design tailed primers that target regions flanking ORF7

    • Perform first-round PCR to amplify the ORF7 region

    • Conduct second-round PCR to add sequencing adapters and indices

    • Quantify libraries and pool in equimolar ratios

  • Sequencing:

    • Use an appropriate Illumina platform (e.g., MiSeq or iSeq100)

    • Target sufficient coverage depth (>1000×) to detect minor variants

  • Data analysis:

    • Filter reads for quality (minimum Phred score Q30)

    • Remove primer sequences and low-quality bases

    • Map reads to reference sequences or de novo assemble

    • Identify consensus sequences for major variants

    • Perform SNV analysis to detect minor variants (≥10% frequency)

    • Calculate the proportion of different variants in mixed samples

  • Interpretation:

    • Identify polymorphic sites that may indicate functional importance

    • Compare variants across different samples to track transmission

    • Assess evolutionary relationships through phylogenetic analysis

This NGS-based approach offers superior sensitivity for detecting diverse ORF7 variants and provides valuable insights into viral population dynamics that would be missed by traditional Sanger sequencing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.