Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF1 (ORF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to suit your needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ORF1; Uncharacterized protein ORF1; Gene 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)
Target Names
ORF1
Target Protein Sequence
MKKSLSLFAIFILTFLGLVIPFITLTAFRPLNEEQYTLKQESSTGKGINETDFINTMFLR SSFFENWSETNYFINPTLKTSKNLLFNDKWYLDFLQDSYSTGVVYDKPGEIFLNYYRQWH SLKNKYMVEKFYDVKKENFLNDLTDFIYAFAVKYKMFDVSKEIVENVDRYKENHYPRVKL KQDNWKLITDYNWLKDNFDNKYYFVIWKQSYSKEWEIMKFKHNMRYDMKIESYIKNNSFK GLYRWDGDGEPQTPTIDKNTGEITDWNSYQQSRVKQFIDLSLYSVLQENIRVQQGGSADY ENPNKVGTKRIIFDFETVDELDVKNIKKAIYRMILTVDEANLIISGSLELNNINNDDLSF NFSFMRTGMGEVFNFNGSIYSSLNSKDLKYYQQFSGQFDLSKFLQSFFASALVPVFQNRS LFIENGYIDNLQYDTVLVNFFALKLQNFNNILLIENINDKLQFDKLLNSMFKISQKFYTN YLRTIFDLENNTYVQGYNKKYGLLVNNGFKIYPRYFYFSDKYKQLDIKLYSAFKNRFYTI NNYGSVFNYDFSVANNYNIKLNSGYVFGGDLQNKYGLQYKKIEEQKIGYNVFELQAQKEN DMYRYYDFNFGIYNWQEINNGGLFPDKQWWQVQYVTPKGWWDFGAHIKNAVIWIVNTIPG VKQVNELASGVGKVFETVYSFFSQIFEVWKFNPALYSTITNIFLLIIFMKFVRLI
Uniprot No.

Target Background

Database Links

KEGG: vg:1260861

Protein Families
Plectrovirus ORF1 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

How does the production of recombinant ORF1 proteins differ from other viral proteins?

The production of recombinant Spiroplasma virus SpV1-R8A2 B ORF1 protein involves several challenges specific to uncharacterized viral proteins:

  • Expression system selection: While E. coli is commonly used , expression hosts must be carefully chosen based on post-translational modifications requirements

  • Solubility optimization: Uncharacterized proteins often require extensive optimization to prevent aggregation

  • Purification strategy: His-tagged purification via metal-chelate affinity chromatography is preferred for initial isolation

Unlike well-characterized viral proteins where functional domains guide expression strategies, uncharacterized proteins like ORF1 require empirical approaches. Drawing parallels from hepatitis virus research, where ORF1 proteins have been successfully tagged with epitopes or functional reporters , similar strategies can be applied to Spiroplasma virus ORF1.

What preliminary characterization techniques should be employed for Spiroplasma virus ORF1 protein?

Initial characterization should follow a systematic approach:

  • SDS-PAGE analysis: Confirm protein size (~715 amino acids, approximately 78-82 kDa depending on tags)

  • Western blot detection: Verify expression using anti-His antibodies for His-tagged versions

  • Mass spectrometry: Confirm protein identity and detect potential post-translational modifications

  • Circular dichroism: Evaluate secondary structure elements

  • Dynamic light scattering: Assess protein homogeneity and aggregation state

For functional assessment, researchers should consider techniques used in related viral protein studies, such as developing subgenomic replicons to test protein functionality in viral replication contexts .

How can researchers effectively design experiments to determine the function of uncharacterized Spiroplasma virus ORF1 protein?

Methodological workflow for functional characterization:

ApproachMethodologyExpected OutcomeAdvantages
Bioinformatic predictionSequence comparison with known viral proteins; Domain prediction using tools like InterPro, PfamPutative functional domains; Evolutionary relationshipsFast, cost-effective initial assessment
Yeast two-hybrid screeningIdentify protein-protein interactions using ORF1 as baitPotential cellular binding partnersDetects direct interactions
Co-immunoprecipitationPull-down assays using recombinant ORF1 with host cell extractsVerification of protein complexesIdentifies physiologically relevant interactions
Transposon-mediated random insertionSimilar to approach used for HEV ORF1 Identify functional and non-functional domainsDetermines critical regions for protein function
CRISPR-Cas9 editingCreate viral mutants with modified ORF1In vivo functional validationProvides physiological context

Begin with computational approaches followed by experimental validation. The transposon-mediated approach has proven particularly valuable for studying uncharacterized viral ORF1 proteins, as demonstrated in hepatitis E virus research .

What expression systems are most suitable for functional studies of Spiroplasma virus ORF1 protein?

The choice of expression system depends on the research objectives:

  • E. coli systems:

    • Advantages: High yield, cost-effective, rapid production

    • Limitations: Lack of post-translational modifications, potential folding issues

    • Recommended for: Initial structural studies, antibody production

  • Insect cell/baculovirus systems:

    • Advantages: Better protein folding, some post-translational modifications

    • Limitations: More complex than bacterial systems

    • Recommended for: Functional studies requiring proper protein folding

  • Mammalian cell systems:

    • Advantages: Most authentic post-translational modifications, proper folding

    • Limitations: Lower yield, higher cost

    • Recommended for: Interaction studies with host factors

  • Cell-free systems:

    • Advantages: Rapid production, avoids toxicity issues

    • Limitations: Lower yield, higher cost

    • Recommended for: Preliminary functional screening

For studying membrane association (as observed with related viral ORF1 proteins ), mammalian expression systems may provide the most physiologically relevant context.

What tagging strategies should be employed for tracking and visualizing Spiroplasma virus ORF1 protein?

Based on successful tagging approaches with related viral ORF1 proteins , the following strategies are recommended:

Recommended tagging approaches:

  • Epitope tags:

    • Small epitopes (HA, FLAG, Myc) for minimal functional interference

    • Place tags at predicted non-functional domains based on structural predictions

    • Terminal tagging (N- or C-terminal) as first approach, internal tagging requires domain knowledge

  • Fluorescent protein fusions:

    • Consider smaller fluorescent proteins (mNeonGreen, mTurquoise2) to minimize functional impact

    • Create both N- and C-terminal fusions to determine optimal configuration

    • For internal tagging, consider split fluorescent proteins

  • Enzymatic tags:

    • NanoLuc or HiBiT tags for sensitive detection with minimal size

    • SNAP/CLIP/Halo tags for specific labeling with synthetic fluorophores

  • Bifunctional approaches:

    • Combined epitope-fluorescent tags for multiple detection methods

    • Conditional tagging systems (e.g., FKBP-based) for inducible visualization

Drawing from hepatitis E virus research, viable insertion sites for tags are often located at domain boundaries rather than within functional domains .

What structural characterization techniques are most appropriate for Spiroplasma virus ORF1 protein?

For comprehensive structural characterization, a multi-technique approach is recommended:

TechniqueApplicationResolutionSample Requirements
X-ray crystallographyHigh-resolution 3D structureAtomic (0.5-3Å)Highly pure, homogeneous protein crystals (mg quantities)
Cryo-electron microscopy3D structure without crystallizationNear-atomic (2-4Å)Pure protein in solution (μg quantities)
Nuclear magnetic resonance (NMR)Solution structure, dynamicsAtomic for smaller proteinsIsotopically labeled protein (mg quantities)
Small-angle X-ray scattering (SAXS)Low-resolution envelope, flexibility10-20ÅMonodisperse protein in solution (mg quantities)
Hydrogen-deuterium exchange MSSolvent accessibility, conformational changesPeptide-levelModerate purity (μg quantities)

For membrane-associated viral proteins like ORF1, which may have both soluble and membrane-associated conformations (similar to HEV ORF1 ), a combination of techniques is essential. Begin with computational structure prediction using AlphaFold2, followed by experimental validation.

How can researchers investigate potential membrane association of Spiroplasma virus ORF1 protein?

Based on findings with hepatitis E virus ORF1 protein, which showed membrane association critical for viral replication , the following methodological approach is recommended:

  • Computational prediction:

    • Analyze hydrophobicity profiles using algorithms like TMHMM, Phobius, or MEMSAT

    • Identify potential transmembrane regions or membrane-interacting domains

  • Experimental validation:

    • Membrane flotation assays: Use density gradient centrifugation to separate membrane and cytosolic fractions

    • Protease protection assays: Determine topology of membrane-associated protein

    • Fluorescence microscopy: Visualize colocalization with known membrane markers

    • FRET-based approaches: Measure proximity to membrane components

  • Functional significance:

    • Mutagenesis: Create variants with altered hydrophobic domains

    • Detergent sensitivity: Test extraction properties with different detergents

    • Liposome binding assays: Quantify interaction with artificial membranes

The membrane association of viral ORF1 proteins often correlates with replication complex formation, as observed in hepatitis E virus studies .

What approaches should be used to investigate the potential role of Spiroplasma virus ORF1 in viral replication?

To characterize the role of ORF1 in viral replication, consider the following comprehensive approach:

  • Replicon-based systems:

    • Develop subgenomic replicons expressing ORF1 with reporter genes

    • Create variants with mutations in predicted functional domains

    • Quantify replication efficiency through reporter activity

  • Protein interaction studies:

    • Identify host factors that interact with ORF1 through:

      • Affinity purification-mass spectrometry

      • Proximity labeling (BioID, APEX)

      • Yeast two-hybrid screening

  • Localization and dynamics:

    • Use fluorescently tagged ORF1 to visualize:

      • Subcellular localization during different stages of infection

      • Co-localization with viral RNA (using FISH techniques)

      • Dynamics of replication complex formation

  • Functional nucleic acid interactions:

    • RNA binding assays to test interaction with viral genomic RNA

    • Chromatin immunoprecipitation to identify potential DNA interactions

    • In vitro polymerase assays if replicase activity is suspected

Drawing parallels from hepatitis E virus research, combining RNA visualization with protein localization through techniques like FISH coupled with immunofluorescence can reveal putative viral replication sites .

How does Spiroplasma virus ORF1 compare to ORF1 proteins from other viral families?

Comparative analysis of ORF1 proteins across viral families reveals important functional and evolutionary insights:

Viral FamilyORF1 Protein FunctionSize RangeKey DomainsReference
Hepeviridae (HEV)Viral replicase with multiple domains1693-1838 aaMethyltransferase, helicase, RdRp
Anelloviridae (TTV)Putative replication-associated proteinVariableHydrophilic C-terminal region
Spiroplasma phageUncharacterized function~715 aaCurrently unknown

Sequence analysis should focus on identifying conserved motifs that might indicate similar functions, particularly in regions associated with viral replication machinery.

What bioinformatic approaches can reveal potential functions of Spiroplasma virus ORF1?

A comprehensive bioinformatic workflow for functional prediction includes:

  • Sequence-based analysis:

    • PSI-BLAST for remote homology detection

    • HHpred for sensitive protein homology detection

    • MEME/GLAM2 for motif discovery

    • Disorder prediction (PONDR, IUPred) for identifying flexible regions

  • Structure-based prediction:

    • AlphaFold2/RoseTTAFold for 3D structure prediction

    • ConSurf for evolutionary conservation mapping

    • ProFunc for structure-based function prediction

    • CASTp for binding pocket identification

  • Integrated approaches:

    • Combine sequence and structural information with machine learning classifiers

    • Use functional networks (STRING, GeneMANIA) to predict associations

    • Phylogenetic profiling to identify co-evolving proteins

The methodology used for hepatitis E virus ORF1 functional domain identification can serve as a template for exploring Spiroplasma virus ORF1, particularly focusing on potential replicase-associated domains.

How can researchers design experiments to test hypotheses about Spiroplasma virus ORF1 protein's role in host-pathogen interactions?

To investigate host-pathogen interactions involving ORF1:

  • Infection model development:

    • Establish appropriate host cell culture systems

    • Create fluorescently labeled virus particles to track infection

    • Develop quantitative assays for viral replication

  • Host response analysis:

    • Transcriptomics of host cells expressing ORF1

    • Proteomic analysis of cells during infection

    • Phosphoproteomics to identify signaling pathways affected

  • Immune recognition studies:

    • Identify potential epitopes in ORF1 recognized by host immune systems

    • Assess innate immune responses to ORF1 expression

    • Analyze antibody responses to recombinant ORF1

  • Functional screening:

    • CRISPR screens to identify host factors required for ORF1 function

    • Small molecule inhibitor screens targeting ORF1-dependent processes

    • Synthetic genetic array analysis in model systems

Drawing parallels from TT virus research, where recombinant ORF1 protein was used to detect anti-viral antibodies in patient sera , similar serological studies could reveal Spiroplasma virus prevalence and host immune responses.

What methods are most suitable for identifying host proteins that interact with Spiroplasma virus ORF1?

For comprehensive interactome analysis:

  • Affinity-based methods:

    • Co-immunoprecipitation (Co-IP): Use tagged ORF1 to pull down interacting partners

    • GST pulldown assays: Test specific interactions with candidate proteins

    • Tandem affinity purification (TAP): Reduce background with sequential purification steps

  • Proximity-based methods:

    • BioID/TurboID: Biotinylate proteins in proximity to ORF1 fusion

    • APEX2: Peroxidase-based labeling of proximal proteins

    • Split-protein complementation: Direct visualization of interactions in cells

  • High-throughput screening:

    • Yeast two-hybrid: Screen cDNA libraries for direct interactors

    • Protein microarrays: Test interactions against thousands of purified proteins

    • Phage display: Identify peptides that bind to ORF1

  • Real-time interaction analysis:

    • Surface plasmon resonance (SPR): Measure binding kinetics

    • Microscale thermophoresis: Quantify interactions in solution

    • Bio-layer interferometry: Determine association/dissociation rates

Studies of hepatitis E virus ORF1 revealed interactions with host cell components, including membrane proteins involved in viral replication complex formation . Similar approaches can identify Spiroplasma virus ORF1 interaction partners.

How can researchers investigate potential nucleic acid binding properties of Spiroplasma virus ORF1?

To characterize ORF1-nucleic acid interactions:

  • In vitro binding assays:

    • Electrophoretic mobility shift assay (EMSA): Detect nucleic acid binding

    • Filter binding assays: Quantify binding affinities

    • Fluorescence anisotropy: Measure binding in solution

    • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters

  • Crosslinking approaches:

    • UV crosslinking: Capture direct interactions

    • CLIP-seq variants: Identify binding sites transcriptome-wide

    • ChIP-seq: Map DNA binding sites genome-wide

  • Structural studies of complexes:

    • NMR spectroscopy: Identify binding interfaces

    • X-ray crystallography: Determine atomic details of interaction

    • Cryo-EM: Visualize large nucleoprotein complexes

  • Functional validation:

    • Mutagenesis of predicted binding sites: Test effect on binding

    • Competition assays: Determine specificity of interactions

    • In vitro enzymatic assays: Test for nucleic acid processing activities

Based on studies of viral replicases like hepatitis E virus ORF1 , investigating RNA binding properties should be prioritized, as these are likely essential for viral genome replication.

How could Spiroplasma virus ORF1 protein be used for diagnostic applications in research settings?

The recombinant ORF1 protein has several potential diagnostic applications:

  • Antibody development:

    • Generation of polyclonal and monoclonal antibodies against ORF1

    • Creation of domain-specific antibodies for detailed localization studies

    • Development of conformation-specific antibodies for different functional states

  • Serological assays:

    • ELISA-based detection of anti-ORF1 antibodies in host samples

    • Western blot confirmation assays

    • Multiplex serological assays for simultaneous detection of multiple viral markers

  • Antigen detection systems:

    • Lateral flow assays for rapid detection

    • Sandwich ELISA for quantitative analysis

    • Mass spectrometry-based approaches for precise identification

  • Research tools:

    • Positive controls for molecular detection methods

    • Standards for quantification assays

    • Calibration material for instrument validation

Drawing from TT virus research, where recombinant ORF1 protein was used to develop Western blot assays for antibody detection , similar approaches could be developed for Spiroplasma virus diagnostics.

What strategies can be employed to develop inhibitors targeting Spiroplasma virus ORF1 functions?

For rational inhibitor development:

  • Target identification:

    • Identify functional domains through deletion/mutation analysis

    • Characterize enzymatic activities (if present)

    • Map interaction sites with host factors

  • Screening approaches:

    • High-throughput screening: Test compound libraries against ORF1 functions

    • Fragment-based screening: Identify chemical starting points for optimization

    • In silico screening: Virtual screening of compound libraries against predicted structures

  • Structure-based design:

    • Use 3D structural information to design targeted inhibitors

    • Rational modification of identified hits based on binding mode

    • Peptidomimetic approaches based on interaction interfaces

  • Validation methods:

    • Biochemical assays to confirm target engagement

    • Cellular assays to verify antiviral activity

    • Resistance selection to confirm mechanism of action

The approaches used for developing inhibitors against hepatitis virus replication can serve as models for targeting Spiroplasma virus ORF1, particularly if replicase activity is confirmed.

How can advanced imaging techniques contribute to understanding Spiroplasma virus ORF1 function in viral replication?

Cutting-edge imaging approaches for studying ORF1 function include:

  • Super-resolution microscopy:

    • STORM/PALM: Achieve 20-30 nm resolution for precise localization

    • STED microscopy: Resolve structures below diffraction limit

    • SIM: Improve resolution 2-fold beyond conventional microscopy

  • Live-cell imaging:

    • FRAP: Measure protein dynamics at replication sites

    • Single-particle tracking: Follow individual ORF1 molecules

    • Optogenetic approaches: Control ORF1 activity with light

  • Correlative microscopy:

    • CLEM: Combine fluorescence with electron microscopy

    • Cryo-CLEM: Preserve native structures for correlative imaging

    • FIB-SEM: Generate 3D reconstructions of replication complexes

  • Multi-modal imaging:

    • Simultaneous RNA-protein visualization: Combine FISH with immunofluorescence

    • Proximity sensors: Detect molecular interactions in real-time

    • Metabolic labeling: Track newly synthesized viral components

The approach used for hepatitis E virus, combining RNA fluorescence in situ hybridization (FISH) with immunofluorescence detection of tagged ORF1 , represents a powerful strategy for visualizing putative replication sites that could be applied to Spiroplasma virus research.

How can systems biology approaches enhance our understanding of Spiroplasma virus ORF1 in the viral life cycle?

Integrated systems approaches include:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Integrate temporal dynamics of host response

    • Map networks of virus-host interactions

  • Mathematical modeling:

    • Kinetic models: Predict replication dynamics

    • Stochastic models: Account for cell-to-cell variability

    • Network models: Understand perturbation effects

  • Single-cell analyses:

    • scRNA-seq: Capture heterogeneity in host response

    • Mass cytometry: Quantify multiple parameters per cell

    • Spatial transcriptomics: Map responses within tissues

  • Synthetic biology approaches:

    • Minimal systems: Reconstruct essential components in vitro

    • Reporter systems: Design sensors for viral processes

    • CRISPR screens: Systematically identify host dependencies

These approaches can reveal the complex interplay between Spiroplasma virus ORF1 and host cellular machinery, similar to insights gained about hepatitis E virus replication complexes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.