Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF2 (ORF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF2; Uncharacterized protein ORF2; Gene 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)
Target Names
ORF2
Target Protein Sequence
MKKFIFFFKNYCYISGSMLLFSLIDLLLWIISLYCVGLVFWILFVLQCIYFVWWLWKNIF YQLNSFGLVNFVWDNPLSVIIGKLGTGKTLLLTYLSQTMKLLTDEIYSNYPLEDDKVKVL TFKNLDFTDRTKPVPPDDSVILFDESYLYIDGTSPHDEKKVHSGKIPWIVLARHFGNRAL FTAQREGMIWNNIRQLASGIIIPISLKKPVIKKGFNFFNRFFIMQIGIFQDITDYEIWKT KSVERTAEGKRVKHKSDVGLGIRFFKIIIPLEFANKYDSQWLKFVRDLKNDEIVNKKEYY WSEITKLSVKERLELFDIDILKKNLKPKKEKGNGKDD
Uniprot No.

Target Background

Database Links

KEGG: vg:1260864

Protein Families
Plectrovirus ORF2 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the basic structural composition of the SpV1-R8A2 B ORF2 protein?

The SpV1-R8A2 B ORF2 protein is a transmembrane protein consisting of three putative transmembrane segments (TMSs): TMS I (residues 36-54), TMS II (residues 72-96), and TMS III (residues 126-146). It is composed of 178 amino acid residues, of which 105 are hydrophobic, making it a protein of low polarity . This hydrophobic composition is consistent with its predicted membrane localization and possible role in membrane-associated functions.

Researchers examining protein properties should employ computational prediction tools such as TMHMM and PHOBIUS to confirm transmembrane domains, along with SignalP for signal peptide prediction. These analyses should be complemented with experimental approaches such as circular dichroism spectroscopy to verify secondary structure elements.

How is the ORF2 gene organized in the SpV1-R8A2 B genome context?

ORF2 in Spiroplasma virus SpV1-R8A2 B is transcribed as a monocistronic mRNA of approximately 1.3 kb. Upstream of ORF2, two sequences (TATAAT at nucleotides 2480-2485 and TTGTTT at nucleotides 2457-2462) resemble the -10 and -35 consensus sequences of eubacterial transcription promoters. Downstream of ORF2, inverted repeat sequences (nucleotides 3744-3760 and 3764-3780) followed by a stretch of uridylic residues suggest a rho-independent terminator .

The gene organization analysis can be conducted using Northern blot hybridization with specific probes. In wildtype strains like GII-3, probes hybridize with a 1.3-kb mRNA, whereas in mutants with disrupted ORF2 (such as G540), no such mRNA is detected, confirming the monocistronic nature of ORF2 transcription .

What experimental evidence supports the functional role of ORF2 in Spiroplasma biology?

The functional significance of ORF2 has been experimentally demonstrated through motility studies with the S. citri mutant G540, which contains a Tn4001 transposon insertion within ORF2. This mutation resulted in loss of motility. When G540 cells were transformed with plasmid pCJ6 carrying the wildtype ORF2, they formed dispersed colonies with satellite colonies and displayed rotational activity when observed by dark-field microscopy, indicating restored motility .

Table 1: Experimental Evidence for ORF2 Function in Motility

Experimental ConditionColony MorphologyMotility StatusMolecular Validation
Wild-type GII-3Dispersed with satellitesMotilePCR amplification with primers CJ6-CJ17 yielded expected fragment
Mutant G540 (ORF2 disrupted)Dense, unsatellitedNon-motilePositive PCR with IS4-CJ8 primers confirming transposon insertion
G540 + pBOT1 vector onlyDense, unsatellitedNon-motileMaintained transposon disruption of ORF2
G540 + pCJ6 (with ORF2)Dispersed with satellitesMotile (rotational activity)Contained both transposon within genomic ORF2 and functional ORF2 on plasmid

Researchers seeking to verify ORF2 function should employ complementation studies using expression vectors, followed by phenotypic characterization and molecular confirmation via PCR amplification with appropriately designed primers targeting both the wild-type gene and any introduced modifications .

How does the ORF2 protein contribute to membrane-associated functions in Spiroplasma?

ORF2 is a transmembrane protein with properties suggesting it may function as an ion transporter. Based on RDD family characteristics, it has been hypothesized that ORF2 could potentially possess Na⁺/H⁺ antiport activity, as it shares structural features with known antiporters—notably its transmembrane nature and low polarity .

To investigate this hypothesis, researchers should employ ion flux assays using fluorescent probes (e.g., BCECF for pH measurements) in cells expressing recombinant ORF2. Additionally, electrophysiological techniques such as patch-clamp recordings could determine if ORF2 forms functional ion channels or transporters. Mutagenesis of conserved residues within the transmembrane domains would help identify amino acids critical for function.

What are the optimal expression systems for producing functional recombinant SpV1-R8A2 B ORF2 protein?

Expression of functional recombinant ORF2 protein requires careful consideration of host systems due to its transmembrane nature. Based on related research with similar viral proteins, the following expression systems have demonstrated success:

  • E. coli expression systems: Can be used with fusion tags (such as His-tag) to facilitate purification, but may require optimization of codon usage and growth conditions to prevent inclusion body formation .

  • Yeast expression systems: Can provide appropriate post-translational modifications and membrane insertion machinery for proper folding of transmembrane proteins.

  • Baculovirus-insect cell expression systems: Often yield higher amounts of properly folded membrane proteins compared to prokaryotic systems .

For experimental design, researchers should:

  • Clone the ORF2 gene into vectors containing appropriate fusion tags (His, GST, etc.)

  • Optimize expression conditions (temperature, induction time, inducer concentration)

  • Validate expression through Western blotting with antibodies against the fusion tag

  • Confirm functionality through complementation assays in Spiroplasma mutants lacking functional ORF2

How can researchers effectively utilize ORF2 in vector development for gene expression in Spiroplasma?

The SpV1 virus of Spiroplasma citri has been successfully used as a vector to express foreign genes in S. citri R8A2 . To develop effective expression vectors incorporating ORF2:

  • Generate recombinant constructs using the replicative form of SpV1 as a backbone, inserting target genes under the control of the ORF2 promoter region (nucleotides 2457-2485).

  • For transformation, use either PEG-mediated protoplast transformation or electroporation protocols optimized for Spiroplasma.

  • Select transformants using appropriate antibiotic markers and verify construct integrity through PCR amplification and sequencing.

  • Validate expression through Northern blotting to detect transcript and Western blotting or functional assays to confirm protein expression.

When designing experiments, researchers should be aware that Spiroplasma uses the UGA codon to encode tryptophan, unlike the universal genetic code where UGA is a stop codon . This necessitates appropriate codon optimization when expressing heterologous genes.

How does SpV1-R8A2 B ORF2 relate to other transmembrane proteins in Spiroplasma viruses?

Comparative analysis of ORF2 with other Spiroplasma virus proteins reveals distinct structural characteristics. While some viral proteins like the phage-derived RecT ssDNA binding protein (found in contig NSRO-P2) have known homologs and functional annotations, ORF2 represents a unique protein with no significant homology to known proteins .

In the NSRO-P2 contig derived from phage-like particles isolated from Spiroplasma poulsonii, researchers identified transmembrane proteins (peg.38 with three transmembrane motifs and peg.39 with one motif) that share similarity with ORF2's membrane topology . This suggests potential conservation of membrane-associated functions across different Spiroplasma viruses.

To investigate evolutionary relationships, researchers should:

  • Perform multiple sequence alignments of ORF2 with similar proteins from related viruses

  • Generate phylogenetic trees using maximum likelihood or Bayesian methods

  • Identify conserved domains that may indicate shared functional constraints

  • Analyze selection pressure (dN/dS ratios) across different regions of the protein

What structural prediction methods are most reliable for uncharacterized proteins like ORF2?

For structural prediction of uncharacterized transmembrane proteins like ORF2, researchers should employ a multi-method approach:

  • Homology modeling: Though ORF2 lacks significant homology with known proteins, even distant homologs can provide structural insights. Tools like I-TASSER, Phyre2, and AlphaFold2 can generate models even with low sequence identity templates.

  • Ab initio modeling: For novel folds, Rosetta membrane protocol or QUARK can generate models based on physicochemical principles rather than homology.

  • Hybrid approaches: Combining sparse experimental data (e.g., from cross-linking mass spectrometry) with computational predictions often yields more accurate models.

  • Transmembrane topology prediction: Tools specifically designed for membrane proteins (TMHMM, PHOBIUS) should be prioritized over general structure prediction methods.

Table 2: Recommended Structural Prediction Methods for ORF2

Method TypeRecommended ToolsAdvantagesLimitations
Homology modelingAlphaFold2, I-TASSERCan identify distant structural homologsLimited by template availability
Transmembrane topologyTMHMM, PHOBIUSSpecialized for membrane protein topologyPredicts topology but not detailed structure
Ab initio modelingRosetta membrane, QUARKDoes not require homologous templatesComputationally intensive, less accurate for larger proteins
Molecular dynamicsGROMACS, NAMDCan simulate protein-membrane interactionsRequires initial structural model
Signal peptide predictionSignalPIdentifies potential secretory signalsLimited to N-terminal signal sequences

What are common challenges in functional characterization of ORF2 and similar uncharacterized proteins?

Researchers working with uncharacterized proteins like ORF2 face several challenges:

  • Expression difficulties: Membrane proteins often yield low expression levels or form inclusion bodies. To address this:

    • Test multiple expression systems (bacterial, yeast, insect cells)

    • Optimize growth conditions (temperature, media, induction parameters)

    • Consider fusion partners that enhance solubility or membrane insertion

  • Functional assay development: Without known function, designing appropriate assays is challenging. Approaches include:

    • Phenotypic complementation in knockout models (as demonstrated with G540 motility restoration)

    • Transmembrane ion flux measurements if ion transport activity is suspected

    • Protein-protein interaction studies to identify binding partners

  • Structural characterization: Membrane proteins are notoriously difficult to crystallize. Alternative approaches include:

    • Cryo-electron microscopy for larger complexes

    • NMR for smaller domains or fragments

    • Cross-linking mass spectrometry to identify spatial relationships between domains

How can researchers address genetic instability issues when working with viral vectors derived from SpV1-R8A2 B?

Previous research indicates that SpV1-derived vectors can exhibit genetic instability through deletion formation by illegitimate and homologous recombination, particularly in host strains lacking functional recA genes . To address this challenge:

  • Vector design optimization:

    • Minimize repetitive sequences that could serve as recombination hotspots

    • Include genetic elements that promote plasmid stability

    • Consider the size of inserted DNA (smaller inserts tend to be more stable)

  • Host strain selection:

    • Choose Spiroplasma strains with stable maintenance of foreign DNA

    • Consider using recA-proficient strains for certain applications

  • Monitoring genetic stability:

    • Regular PCR-based screening of transformants to detect deletions or rearrangements

    • Sequence verification after multiple passages

    • Restriction enzyme analysis to detect major structural changes

  • Culture conditions:

    • Optimize growth conditions to minimize stress that could induce recombination

    • Avoid unnecessary passages that could select for deletion variants

When conducting complementation experiments with ORF2, researchers should verify the genetic integrity of their constructs throughout the experimental timeline to ensure that phenotypic observations are attributable to the intended genetic modifications rather than spontaneous deletions or rearrangements.

How might systems biology approaches enhance our understanding of ORF2 function in the context of virus-host interactions?

Systems biology approaches offer powerful tools for understanding uncharacterized proteins like ORF2:

  • Transcriptomics: RNA-seq analysis comparing wild-type and ORF2 mutant Spiroplasma could reveal genes whose expression changes in response to ORF2 disruption, providing clues to its functional network. Similar approaches with orf2 mutants in Streptomyces revealed differential expression of 1582 genes, including upregulation of ribosomal proteins, amino acid biosynthesis pathways, and aminoacyl-tRNA synthetases .

  • Proteomics: Mass spectrometry-based approaches could identify proteins that interact with ORF2 or whose abundance changes in ORF2 mutants.

  • Metabolomics: If ORF2 is involved in ion transport, metabolomic analyses might reveal changes in cellular metabolites that depend on ion gradients.

  • Network analysis: Integration of multi-omics data could position ORF2 within functional networks, suggesting biological processes it might influence.

Researchers should design experiments with appropriate biological replicates and controls, including complemented mutants to verify that observed changes are specifically due to ORF2 disruption rather than secondary mutations or polar effects.

What emerging technologies might advance structural and functional studies of ORF2?

Several emerging technologies show promise for advancing ORF2 research:

  • Cryo-electron microscopy (cryo-EM): Recent advances in resolution now enable structural determination of smaller membrane proteins without crystallization.

  • Single-molecule FRET: Can provide insights into conformational changes of ORF2 during potential transport cycles.

  • Nanodiscs technology: Provides a more native-like membrane environment for functional studies of membrane proteins compared to detergent micelles.

  • CRISPR-Cas9 genome editing: Could enable more precise genetic manipulation of Spiroplasma to study ORF2 function in vivo.

  • Microfluidics-based approaches: Allow high-throughput screening of conditions affecting ORF2 function or stability.

  • Computational methods: Advanced molecular dynamics simulations with specialized force fields for membrane proteins can predict functional mechanisms and guide experimental design.

By integrating these advanced technologies with established biochemical and genetic approaches, researchers can develop a more comprehensive understanding of this currently uncharacterized protein and its role in Spiroplasma virus biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.