Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF6 (ORF6)

Shipped with Ice Packs
In Stock

Description

Introduction to Spiroplasma Virus and ORF6 Protein

Spiroplasma virus SpV1-R8A2 B (SpV1) belongs to a group of viruses that infect Spiroplasma bacteria, characterized as a single-stranded circular DNA virus . These viruses are significant in understanding viral-bacterial interactions and evolutionary relationships between different viral families. The ORF6 protein from Spiroplasma virus represents one of several uncharacterized open reading frames (ORFs) within the viral genome that encode proteins with functions that remain to be fully elucidated.

The study of viral ORF proteins has gained considerable attention, particularly as researchers discover homologous relationships between seemingly unrelated viral proteins. Interestingly, the ORF6 protein from Spiroplasma virus has drawn scientific interest due to its potential evolutionary relationship with proteins from other viruses, including coronaviruses and lentiviruses . This relationship suggests that these viral elements may share common ancestry or convergent evolutionary pathways.

Evolutionary Context of Viral ORF6 Proteins

Comparative genomic analyses have revealed surprising relationships between viral ORF proteins across different viral families. The Spiroplasma virus ORF6 protein exhibits structural and functional similarities to proteins found in more complex mammalian viruses . This evolutionary connection provides valuable insights into viral adaptation and cross-species transmission mechanisms, which remain central questions in virology.

Molecular Properties

The Spiroplasma virus ORF6 protein is characterized as a relatively small protein compared to other viral proteins. Based on comparative analyses with similar viral proteins, ORF6 is estimated to be approximately 63 amino acids in length, which places it among the smaller functional viral proteins . Like many viral accessory proteins, it likely contains at least one transmembrane domain that facilitates its interaction with cellular membranes .

Comparative Analysis with Other Viral ORF6 Proteins

Homology studies have revealed notable similarities between Spiroplasma virus ORF6 and other viral proteins. Most significantly, it shares structural features with the Gene 6 protein from other Spiroplasma viruses, suggesting a conserved function within this viral family . The table below summarizes key comparative features of viral ORF6 proteins:

Viral ProteinLength (aa)Transmembrane DomainsRelated Viral ProteinsHost Organism
Spiroplasma virus ORF6~631Gene 6 protein (VG6_SPV1R)Spiroplasma bacteria
SARS-CoV ORF6631Vpu proteinHumans
SARS-CoV-2 ORF6611Interferes with STAT1 nuclear localizationHumans

This comparative analysis demonstrates the structural conservation of ORF6 proteins across different viral species, suggesting a potential evolutionary relationship or functional convergence .

Expression Systems

The production of recombinant viral proteins typically employs prokaryotic expression systems, with Escherichia coli being the most common host organism for initial expression studies . For Spiroplasma virus proteins, similar approaches to those used for other viral proteins would likely be employed, including:

  1. Cloning the ORF6 gene into an appropriate expression vector

  2. Introducing an affinity tag (such as a His-tag) to facilitate purification

  3. Optimizing expression conditions to maximize protein yield and solubility

  4. Establishing purification protocols to obtain high-purity protein samples

Purification Methodology

Based on standard recombinant protein production protocols for viral proteins, the purification of Spiroplasma virus ORF6 would typically involve the following steps:

  1. Cell lysis to release the expressed protein

  2. Affinity chromatography using the introduced tag (typically His-tag)

  3. Size exclusion chromatography to separate the protein from contaminants

  4. Assessment of purity using SDS-PAGE analysis

  5. Lyophilization or buffer exchange for storage and experimental use

The purified recombinant protein would likely be stored in appropriate buffer conditions, potentially with stabilizers such as trehalose, to maintain its structural integrity during storage .

Predicted Functions Based on Homology

While the precise function of Spiroplasma virus ORF6 remains uncharacterized, homology-based predictions suggest potential roles in viral-host interactions. The limited available information indicates that this protein may have functions related to those observed in homologous proteins from other viruses .

Comparative Functional Analysis with SARS-CoV-2 ORF6

The better-studied SARS-CoV-2 ORF6 provides some insights into potential functions of Spiroplasma virus ORF6. SARS-CoV-2 ORF6 functions as a virulence factor through:

  1. Direct interaction with STAT1 to inhibit its nuclear translocation

  2. Binding to importin α1 (encoded by KPNA2) to suppress nuclear transport

  3. Disruption of nucleocytoplasmic trafficking to enhance viral replication

Given the structural similarities between these proteins, Spiroplasma virus ORF6 might similarly interfere with host cellular processes, albeit adapted to its bacterial host environment .

Evolutionary Significance

The structural and potential functional similarities between Spiroplasma virus ORF6 and proteins from viruses that infect mammals suggest fascinating evolutionary connections. These similarities indicate that certain viral mechanisms may be conserved across diverse host ranges, from bacteria to humans . The table below summarizes these evolutionary relationships:

Viral ProteinHost TypeEvolutionary Relationship
Spiroplasma virus ORF6Bacterial (Spiroplasma)Ancestral viral protein
SARS-CoV/SARS-CoV-2 ORF6MammalianConvergent evolution or distant homology
HIV-1 Vpu proteinMammalianStructural similarity despite different viral families

This evolutionary connection underscores the remarkable conservation of certain viral protein functions across divergent viral families .

Comparative Virology Studies

The study of Spiroplasma virus ORF6 contributes to our understanding of viral evolution and adaptation mechanisms. By comparing ORF6 proteins across different viral families, researchers can trace evolutionary pathways and identify conserved functional domains . This comparative approach provides insights into how viruses evolve to infect different host species and overcome host defense mechanisms.

Potential Biotechnological Applications

Understanding the structure and function of viral proteins like Spiroplasma virus ORF6 may lead to novel biotechnological applications, including:

  1. Development of viral protein-based research tools

  2. Creation of protein engineering platforms

  3. Identification of novel targets for antiviral strategies

  4. Design of protein-based biosensors or diagnostic tools

Knowledge Gaps

Despite the progress in understanding viral ORF proteins, significant knowledge gaps remain regarding Spiroplasma virus ORF6:

  1. The precise three-dimensional structure remains unresolved

  2. Specific host interaction partners are largely unknown

  3. Detailed biochemical properties require further characterization

  4. The role in viral replication cycle needs clarification

Future Research Priorities

To address these knowledge gaps, future research should focus on:

  1. Determining the crystal structure of Spiroplasma virus ORF6

  2. Identifying host proteins that interact with ORF6

  3. Characterizing the biochemical properties and enzymatic activities (if any)

  4. Investigating the role of ORF6 in viral replication and pathogenicity

  5. Exploring evolutionary relationships with other viral proteins in greater detail

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ORF6; Uncharacterized protein ORF6; Gene 6 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)
Target Names
ORF6
Target Protein Sequence
MDMKFWTTKEYKKIKRDFIIRNFAFGFCYFLFLISFIMCIVCFIISINFEVEIILVILFP FLLLILSVWNLFDLIMEHISEIKRFKVTVLKKQIEELEGKMLRGLRVGVDKIE
Uniprot No.

Target Background

Database Links

KEGG: vg:1260866

Subcellular Location
Host membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.