Recombinant Spodoptera frugiperda ascovirus 1a Uncharacterized protein ORF12 (ORF12)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Spodoptera frugiperda Ascovirus 1a Uncharacterized Protein ORF12 (ORF12)

Recombinant Spodoptera frugiperda ascovirus 1a Uncharacterized protein ORF12 (ORF12) is a synthetically engineered version of a viral protein derived from Spodoptera frugiperda ascovirus 1a (SfAV-1a), a lepidopteran-specific DNA virus. ORF12 is one of 123 open reading frames (ORFs) identified in the SfAV-1a genome, with no confirmed functional annotation in current literature . The recombinant protein is produced in E. coli and includes an N-terminal His-tag for purification and detection .

Genomic and Viral Context

SfAV-1a is a member of the Ascoviridae family, which induces apoptosis in host cells to generate virion-containing vesicles for transmission . While most SfAV-1a ORFs encode enzymes (e.g., caspases, kinases, lipid metabolism proteins) or structural virion proteins, 79 remain uncharacterized . ORF12 falls into this latter category, with no homologs identified in other viruses or functional domains mapped to date .

Experimental Applications

Recombinant ORF12 is primarily used for:

  • Antibody Development: ELISA kits for detecting ORF12-specific antibodies in research settings .

  • Protein Interaction Studies: Investigating potential roles in viral replication or host-cell interactions.

  • Structural Analysis: X-ray crystallography or NMR studies, leveraging its His-tag for purification .

Research Challenges and Gaps

  1. Functional Ambiguity:

    • No evidence links ORF12 to SfAV-1a’s apoptotic machinery (e.g., caspases, IAP-like proteins) or virion assembly .

    • Proteomic analyses of SfAV-1a virions identified 21 structural proteins (e.g., ORF009, ORF047), but ORF12 was absent .

  2. Transcriptomic Insights:

    • RNA-Seq studies in S. frugiperda larvae revealed temporal expression patterns for SfAV-1a genes, but ORF12 was not among the highly expressed or functionally annotated genes .

  3. Comparative Genomics:

    • ORF12 shows no significant homology to proteins in Chilo iridescent virus or other ascoviruses, limiting evolutionary inferences .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ORF12; Uncharacterized protein ORF12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Spodoptera frugiperda ascovirus 1a (SfAV-1a)
Target Names
ORF12
Target Protein Sequence
MMSSVTSEIIHTDVSGQRVRPPLTYCNGELGLKNSEDAAYFCLEKFKSFNEVPDFQYIYL TLSLHVPPPTRKYLLKFHKRLLNVCRLCGETGDLVGGRVLVSGVSQKTADIVVSAKSNGE VLYDWSNFFKSTVRVRCRYTIAKLYNNKAAMREIAKQKNWQTTYPNLEAYRKLNDAAKNS KHTPIVSIQTPPPPAPTPNRPDVPASKNVVITQRYQKPVEKIEDSRLETTRISVIPLLSV LLLVIIIILL
Uniprot No.

Target Background

Database Links

KEGG: vg:4306179

Protein Families
Ascovirus HvAV ORF18 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does ORF12 fit into the broader context of ascovirus biology?

ORF12 is one of several hypothetical proteins encoded by SfAV-1a with predicted transmembrane domains. Ascoviruses have a unique replication cycle that involves nuclear hypertrophy, cleavage of host DNA, nuclear lysis, and cellular fragmentation leading to the formation of virion-containing vesicles .

In the context of ascovirus biology, proteins with transmembrane domains like ORF12 potentially play important roles in:

  • Viral vesicle formation and structure

  • Viral-host membrane interactions

  • Modulation of host cell death pathways

  • Viral assembly and compartmentalization

Understanding ORF12's function may provide insights into the unusual cytopathology of ascoviruses, which involves a modified form of apoptosis where developing apoptotic bodies are "rescued" by the virus to form viral vesicles .

What are the temporal and spatial expression patterns of ORF12 during SfAV-1a infection?

Transcriptomic analysis reveals that ORF12 expression varies both temporally and spatially during infection. Expression data shows:

Tissue Type7 days post-infection (dpi)14 dpi21 dpi
Somatic tissues28.7025.5825.27
Hemolymph71.04133.4843.09

These RPKM (Reads Per Kilobase Million) values indicate that ORF12 is expressed at higher levels in hemolymph compared to somatic tissues, with peak expression in hemolymph occurring at 14 dpi. This expression pattern correlates with the biology of ascovirus infection, where viral vesicles circulate in the hemolymph .

The higher expression in hemolymph is consistent with ORF12's potential role in the viral vesicle phase of infection, which primarily occurs in the hemolymph. Methodologically, this suggests that studies focused on ORF12 function should examine both early infection in somatic tissues and later stages in hemolymph .

How does ORF12 expression compare to other transmembrane proteins encoded by SfAV-1a?

When comparing ORF12 expression to other SfAV-1a genes encoding proteins with predicted transmembrane helices:

  • ORF12 shows moderate expression levels compared to highly expressed transmembrane proteins like ORF097 (RING finger domain) and ORF035 (Lipid membrane protein), which show RPKM values >1000 in hemolymph.

  • ORF12's expression pattern (higher in hemolymph than somatic tissues) is similar to several other transmembrane proteins including ORF085, ORF086, and ORF093.

  • Unlike some transmembrane proteins that maintain consistent expression levels across time points, ORF12 shows a distinct peak at 14 dpi in hemolymph, suggesting potential involvement in specific temporal processes during virus replication .

This comparative analysis indicates that while ORF12 is not among the most highly expressed transmembrane proteins, its distinct expression pattern warrants further investigation into its specific function during the viral replication cycle.

What methodologies are recommended for characterizing the membrane topology of ORF12?

Given that ORF12 contains a predicted transmembrane helix, several complementary approaches are recommended for determining its membrane topology:

  • Computational prediction refinement:

    • Use multiple topology prediction algorithms beyond TMHMM, such as MEMSAT, OCTOPUS, and TOPCONS

    • Apply hydrophobicity analysis to identify potential membrane-spanning regions

    • Perform comparative analysis with characterized transmembrane proteins

  • Experimental approaches:

    • Protease protection assays using the recombinant His-tagged protein in membrane environments

    • Epitope insertion combined with immunofluorescence microscopy

    • FRET-based analyses to determine proximity to known membrane proteins

    • Cysteine scanning mutagenesis followed by selective labeling of exposed residues

  • Integrative structural biology:

    • Cryo-electron microscopy of ORF12 in reconstituted membrane systems

    • NMR spectroscopy of isotopically labeled protein in membrane mimetics

    • Cross-linking mass spectrometry to identify adjacent protein partners

The recombinant His-tagged ORF12 available commercially provides an excellent starting point for these analyses, as the tag can be leveraged for purification and detection in many of these approaches .

How might ORF12's transmembrane domain contribute to SfAV-1a infection mechanisms?

Based on our understanding of ascovirus biology and ORF12's properties, several hypotheses regarding its transmembrane domain's function can be proposed:

  • Viral vesicle formation: The transmembrane domain might play a structural role in viral vesicle formation, particularly during the transition from apoptotic bodies to viral vesicles. Research on other viruses suggests that viral transmembrane proteins can induce membrane curvature and vesiculation .

  • Host-cell reprogramming: Given that ascovirus infection involves significant cytoskeletal rearrangements, ORF12 might interact with host cytoskeletal elements to facilitate these changes. Studies have shown that during ascovirus infection, multiple cytoskeleton genes are upregulated, including 29 tubulins, 21 actins, 21 dyneins, and 13 kinesins at 48 hours post-infection .

  • Mitochondrial interaction: Since ascovirus infection preserves mitochondria (unlike typical apoptosis), ORF12 might be involved in mitochondrial membrane interactions that prevent complete apoptotic cell death. This would be consistent with the observation that mitochondrial genes remain expressed at levels comparable to controls even after 21 days post-infection .

Methodologically, these hypotheses could be tested through co-localization studies, protein-protein interaction assays, and targeted mutagenesis of the transmembrane domain followed by infection studies.

What are the optimal conditions for reconstitution and storage of recombinant ORF12 protein?

Based on the manufacturer's recommendations:

  • Reconstitution procedure:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Store reconstituted protein aliquots at -20°C/-80°C for long-term storage

    • For working aliquots, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they may affect protein stability

  • Buffer considerations:

    • The protein is supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • This buffer maintains stability during lyophilization and initial reconstitution

    • For specific applications, buffer exchange may be necessary but should be validated experimentally

These recommendations ensure optimal protein stability and activity for downstream applications.

What advanced microscopy techniques would be most effective for studying ORF12 localization during infection?

Given the complex cellular rearrangements during ascovirus infection, several advanced microscopy techniques are particularly suited for studying ORF12 localization:

  • Super-resolution microscopy approaches:

    • Stimulated emission depletion (STED) microscopy would allow visualization of ORF12 in relation to cellular membranes below the diffraction limit

    • Photoactivated localization microscopy (PALM) or stochastic optical reconstruction microscopy (STORM) could be used to track ORF12 during vesicle formation with nanometer precision

  • Live-cell imaging strategies:

    • Lattice light-sheet microscopy would enable long-term, low-phototoxicity imaging of the infection process

    • Fluorescence recovery after photobleaching (FRAP) could assess ORF12 mobility within membranes

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion properties in different membrane compartments

  • Correlative approaches:

    • Correlative light and electron microscopy (CLEM) would allow precise localization of ORF12 in the context of ultrastructural changes during infection

    • Cryo-electron tomography of infected cells would provide structural context for ORF12 function

For these approaches, antibodies against the recombinant His-tagged ORF12 could be used, or alternatively, viral genomes could be engineered to express fluorescently tagged ORF12. Time course experiments should focus on critical transition points in infection, particularly between 24-72 hours post-infection when nuclear lysis and vesicle formation occur, and later time points (7-14 dpi) when ORF12 expression peaks in the hemolymph .

How does ORF12 differ from other uncharacterized transmembrane proteins in ascoviruses?

Comparative analysis of ORF12 with other ascovirus transmembrane proteins reveals several distinguishing features:

  • Sequence conservation:

    • ORF12 shows limited sequence homology to other ascovirus proteins, suggesting a specialized function

    • Unlike some conserved structural proteins, ORF12 appears to be relatively unique to SfAV-1a

  • Expression pattern:

    • ORF12 shows a distinctive expression profile with a pronounced peak at 14 dpi in hemolymph (133.48 RPKM)

    • This differs from constitutively expressed transmembrane proteins like ORF097 (RING finger domain) which maintains high expression levels throughout infection

    • ORF12 also differs from proteins primarily expressed in somatic tissues like ORF032

  • Structural predictions:

    • The transmembrane helix in ORF12 is predicted near the C-terminus, unlike some other transmembrane proteins

    • The protein lacks recognizable functional domains found in other transmembrane proteins such as enzymatic domains (like those in ORF014, a zinc-dependent metalloproteinase) or RING finger domains (like in ORF097)

These differences suggest that ORF12 may have evolved to serve a specialized function in SfAV-1a that is distinct from other transmembrane proteins.

How might functional studies of ORF12 inform broader understanding of ascovirus-host interactions?

Functional characterization of ORF12 could provide valuable insights into several key aspects of ascovirus biology:

  • Cell death modulation mechanisms:

    • Ascoviruses utilize regulated cell death (RCD) pathways in unique ways, interrupting apoptosis to form viral vesicles

    • If ORF12 is involved in this process, its study could reveal novel mechanisms by which viruses manipulate host cell death pathways

    • This could clarify whether ORF12 contributes to the "anti-apoptotic" or "pyroptotic" aspects of ascovirus infection reported in recent studies

  • Viral vesicle formation:

    • The formation of viral vesicles is a distinctive feature of ascoviruses

    • ORF12's transmembrane properties and expression pattern suggest potential involvement in vesicle formation or maintenance

    • Functional studies could provide molecular detail on how viral proteins transform apoptotic bodies into viral vesicles

  • Host range determination:

    • Different ascoviruses show varied tissue tropism and host specificity

    • If ORF12 interacts with host-specific factors, it might contribute to these differences

    • Comparative studies across different host species could reveal how ORF12-like proteins influence host range

Methodologically, approaches such as gene knockout/knockdown, protein-protein interaction studies, and heterologous expression in different host systems would be valuable for addressing these questions.

What are the methodological challenges in developing a reverse genetics system to study ORF12 function?

Developing a reverse genetics system for studying ORF12 presents several technical challenges:

  • Large genome manipulation:

    • The SfAV-1a genome is large (approximately 156 kbp), making standard cloning approaches difficult

    • Methodological solutions include:

      • Bacterial artificial chromosome (BAC) systems adapted for large viral genomes

      • In vitro CRISPR-Cas9 genome editing of purified viral DNA

      • Recombination-based approaches using homologous flanking sequences

  • Verification challenges:

    • Confirming successful genetic modifications without disrupting other viral functions

    • Recommended approaches:

      • Next-generation sequencing to verify genome integrity

      • Multi-locus PCR scanning to detect unwanted rearrangements

      • Transcriptomic analysis to ensure normal expression of adjacent genes

  • Phenotypic analysis complexity:

    • The unique infection cycle of ascoviruses makes phenotypic assessment challenging

    • Methodological considerations:

      • Quantitative time-course microscopy to track vesicle formation

      • Flow cytometry of hemolymph to analyze viral vesicle properties

      • Comparative proteomics of wild-type versus mutant viral vesicles

  • Complementation systems:

    • Developing systems to express ORF12 in trans to rescue potential lethal mutations

    • Approaches could include:

      • Inducible expression systems in insect cell lines

      • Helper virus-based complementation

      • Cell lines stably expressing ORF12 variants

These methodological challenges require innovative approaches that combine traditional virology techniques with modern genomic and microscopy methods .

How might the expression pattern of ORF12 inform experimental design for functional studies?

The unique temporal and spatial expression pattern of ORF12 provides important guidance for designing functional studies:

  • Time point selection:

    • Based on RPKM data showing peak expression at 14 dpi in hemolymph, functional studies should focus on:

      • Early time points (24-48 hpi) to study initial expression and localization

      • Mid-infection period (7 dpi) when expression begins to increase in hemolymph

      • Peak expression period (14 dpi) for interaction studies and functional analyses

      • Late infection (21 dpi) to understand sustained expression requirements

  • Tissue-specific approaches:

    • Given the higher expression in hemolymph compared to somatic tissues, experiments should:

      • Compare ORF12 function between tissue types

      • Investigate hemolymph-specific interactions

      • Consider hemocyte cell lines for in vitro studies

      • Develop hemolymph-focused isolation techniques for viral vesicles

  • Quantitative consideration:

    • The moderate expression levels of ORF12 compared to some highly expressed viral genes suggests:

      • Potential regulatory rather than structural role

      • Need for sensitive detection methods in some experimental contexts

      • Potential for biochemical enrichment before certain analyses

  • Comparative framework:

    • Expression data from both SfAV-1a and TnAV-6a1 systems provides opportunities for:

      • Cross-species functional comparisons

      • Investigation of host-specific expression regulation

      • Identification of conserved versus divergent functions

By aligning experimental design with the established expression patterns, researchers can maximize the likelihood of capturing relevant biological activities of ORF12.

How might ORF12 interact with host cytoskeletal elements during infection?

The potential interaction between ORF12 and host cytoskeletal components represents an important research direction based on several observations:

  • Temporal correlation:

    • Ascovirus infection induces significant upregulation of host cytoskeletal genes at 48 hpi, including tubulins, actins, dyneins, and kinesins

    • This coincides with the early expression of ORF12 and the beginning of viral vesicle formation

  • Potential interaction mechanisms:

    • As a transmembrane protein, ORF12 could:

      • Directly bind to cytoskeletal elements at the membrane interface

      • Participate in complexes that anchor the cytoskeleton to viral membranes

      • Modulate cytoskeletal dynamics through signaling pathways

  • Methodological approaches to investigate interactions:

    • Co-immunoprecipitation with cytoskeletal components

    • Proximity labeling techniques (BioID, APEX) to identify near-neighbors

    • Live-cell imaging of fluorescently tagged ORF12 with labeled cytoskeletal elements

    • In vitro binding assays with purified components

  • Functional validation strategies:

    • Mutagenesis of putative cytoskeleton interaction motifs in ORF12

    • Cytoskeleton disrupting drugs applied at different infection stages

    • Competitive inhibition with peptides derived from interaction interfaces

Understanding these interactions could reveal how ORF12 contributes to the dramatic cellular remodeling observed during ascovirus infection.

What role might ORF12 play in the preserved mitochondrial function during ascovirus infection?

An intriguing aspect of ascovirus infection is the preservation of mitochondrial function, in contrast to typical apoptosis where mitochondria are destroyed. ORF12 may contribute to this phenomenon:

  • Potential mechanisms:

    • ORF12's transmembrane domain might:

      • Interact with mitochondrial membrane proteins

      • Influence mitochondrial membrane potential

      • Inhibit pro-apoptotic mitochondrial membrane permeabilization

      • Regulate mitochondrial dynamics (fusion/fission)

  • Supporting observations:

    • Mitochondrial genes remain expressed at near-normal levels even after 21 days post-infection

    • Mitochondrial ribosomal activity (rRNAs and tRNAs) is upregulated during infection

    • Ascovirus vesicles contain active mitochondria that support virus replication

  • Experimental approaches:

    • Mitochondrial co-localization studies with fluorescently tagged ORF12

    • Measurement of mitochondrial parameters (membrane potential, ROS production) in cells expressing ORF12

    • Analysis of interactions between ORF12 and mitochondrial proteins

    • Comparative analysis of ORF12 knockout/knockdown effects on mitochondrial preservation

  • Methodological considerations:

    • Time course experiments should capture both early infection and late vesicle stages

    • Both in vitro and in vivo systems should be employed for comprehensive analysis

    • Multi-parameter mitochondrial function assays are preferable to single measurements

This research direction could reveal novel mechanisms by which viruses preserve mitochondrial function for their replication advantage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.