Recombinant Sporisorium reilianum High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
SHO1; sr14199; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Sporisorium reilianum (strain SRZ2) (Maize head smut fungus)
Target Names
SHO1
Target Protein Sequence
MPGKRGGGGGIDIGLIFAHKILTVLLLLSTVGWIVAFIGQCAAEAGSGGRQGVLWFAIFL QLFLIVAKYLLVMTDSLGTHRLQLTTFTSIALVFSVIGINSGIYSSNSSEEAVAAGWFLI TLTNIVWLLFLTTEEESALYPIVNIANDGVTPPAARTSGRYNGGGGAGGQSMRMAGGGAG TGLGGAGYAAGNGSAYSGGFQGGAAGGYQPAFGNSPSAADITTANGTGLGAPKMSSAASV RSRAANDTATGGVGGISQDAPSVASHGAPASPAQPGAKGSELPDYGYKARALYAYQANAD DPTEISFSKGEVLDIVDNSGKWWQARKSNGETGIVPSNYMQLL
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sporisorium reilianum and why is its SHO1 protein significant for research?

Sporisorium reilianum is a biotrophic smut fungus that infects maize (Zea mays) and sorghum (Sorghum bicolor), causing smut disease . The fungus systemically colonizes its host plants by growing along the vascular bundles, initially without inducing obvious symptoms . The High Osmolarity Signaling protein SHO1 is significant because it likely plays a crucial role in the fungal response to osmotic stress conditions and potentially in host-pathogen interactions. Understanding SHO1's function could provide insights into S. reilianum's pathogenicity mechanisms and potential targets for disease control strategies.

What is the structural composition of recombinant SHO1 protein?

The recombinant full-length Sporisorium reilianum SHO1 protein consists of 343 amino acids (1-343aa) and is typically expressed with an N-terminal His-tag to facilitate purification . The protein is encoded by the SHO1 gene in the S. reilianum genome. Based on homology with SHO1 proteins in related fungi, it likely contains transmembrane domains and a cytoplasmic SH3 domain that mediates protein-protein interactions in signaling cascades.

How does SHO1 function in osmotic stress response pathways?

SHO1 typically functions as a membrane sensor in the High Osmolarity Glycerol (HOG) pathway, which is conserved across many fungi. When environmental osmolarity increases, SHO1 acts as a sensory molecule that initiates a signaling cascade ultimately resulting in adaptive responses. In pathogenic fungi, this pathway is often linked to virulence, as the ability to respond to osmotic changes is critical during host colonization.

What are the optimal expression systems for recombinant SHO1 production?

For recombinant SHO1 production, E. coli is commonly used as demonstrated in the available product information . For optimal expression:

  • Use BL21(DE3) or Rosetta E. coli strains for better expression of fungal proteins

  • Consider using a construct with an N-terminal His-tag for purification purposes

  • Express at lower temperatures (16-20°C) to improve protein folding

  • Use auto-induction media or carefully optimized IPTG concentrations to maximize yield

  • Include osmotic stabilizers in the growth media to potentially improve folding of this osmolarity sensor protein

For more complex studies requiring post-translational modifications, yeast expression systems such as Pichia pastoris might be more appropriate.

What purification strategies yield the highest purity and activity for recombinant SHO1?

For His-tagged SHO1 protein , a multi-step purification approach is recommended:

Purification StepMethodologyExpected Outcome
Initial CaptureNi-NTA affinity chromatography>80% purity
Intermediate PurificationIon exchange chromatography>90% purity
PolishingSize exclusion chromatography>95% purity
Buffer OptimizationTest various pH (6.5-8.0) and salt concentrations (150-500mM NaCl)Optimized stability

When purifying membrane-associated proteins like SHO1, consider including mild detergents (0.03-0.1% DDM or 0.1% CHAPS) in all buffers to maintain solubility. Verify protein activity through functional assays such as osmolarity-dependent conformational changes or binding to known interaction partners.

How can researchers effectively study SHO1's role in S. reilianum pathogenicity?

To investigate SHO1's role in pathogenicity, consider these methodological approaches:

  • Gene knockout/knockdown studies: Generate SHO1-deficient mutants using CRISPR-Cas9 technology similar to the approach used in creating recombinant hybrids of S. reilianum .

  • Complementation assays: Reintroduce wild-type or mutated versions of SHO1 into knockout strains to verify phenotypes.

  • Host infection assays: Compare virulence of wild-type and SHO1-deficient strains in maize or sorghum.

  • Protein localization studies: Create fluorescently tagged SHO1 proteins to track subcellular localization during infection.

  • Transcriptome analysis: Compare gene expression patterns in wild-type versus SHO1-deficient strains under osmotic stress and during host infection.

When designing these experiments, include appropriate controls and consider the timing of sample collection as S. reilianum shows different growth patterns at various stages of infection .

What techniques can reveal SHO1 protein interaction networks?

To identify and characterize SHO1 protein interactions:

  • Yeast two-hybrid screening: Use SHO1 as bait to screen for potential interaction partners.

  • Co-immunoprecipitation: Utilize His-tagged SHO1 for pull-down assays followed by mass spectrometry.

  • Bimolecular Fluorescence Complementation (BiFC): Visualize protein interactions in vivo.

  • Surface Plasmon Resonance (SPR): Determine binding kinetics of identified interactions.

  • Protein cross-linking coupled with mass spectrometry: Identify transient interaction partners.

When analyzing results, compare interactions under different osmotic conditions to identify condition-specific interactions that might be relevant to pathogenicity.

How does SHO1 compare across different fungal species and strains?

When comparing SHO1 across fungal species, researchers should:

  • Perform multiple sequence alignments with SHO1 homologs from related species like Ustilago maydis and Sporisorium scitamineum.

  • Identify conserved domains that suggest functional importance.

  • Analyze strain-specific variations similar to the polymorphisms observed in the cox1 gene between German and Chinese S. reilianum strains .

  • Compare SHO1 gene regulatory regions to identify potential differences in expression patterns.

  • Consider whether hybrid models, like the recombinant U. maydis X S. reilianum hybrid (rUSH) , could be useful for studying functional conservation.

This comparative approach can reveal evolutionary adaptations in osmosensing mechanisms across different ecological niches and host specificities.

What bioinformatic approaches are most suitable for analyzing SHO1 sequence-function relationships?

For robust bioinformatic analysis of SHO1:

  • Employ multiple sequence alignment tools (MUSCLE, CLUSTALΩ) to identify conserved regions across species.

  • Use protein structure prediction (AlphaFold2, I-TASSER) to model SHO1's tertiary structure.

  • Implement molecular dynamics simulations to predict conformational changes under different osmotic conditions.

  • Utilize gene synteny analysis similar to that performed for mitochondrial genes to examine evolutionary conservation of the genomic context.

  • Apply machine learning approaches to identify patterns in sequence variations that correlate with pathogenicity or host specificity.

These analyses can guide the design of targeted mutagenesis experiments to test hypotheses about structure-function relationships.

How might genetic diversity within S. reilianum populations affect SHO1 function?

The genetic diversity observed in mitochondrial genes like cox1 between German and Chinese S. reilianum strains suggests that similar diversity might exist in nuclear-encoded genes like SHO1. To investigate this:

  • Sequence SHO1 from geographically diverse S. reilianum isolates.

  • Analyze any polymorphisms for potential functional consequences using predictive algorithms.

  • Develop diagnostic PCR primers similar to those designed for cox1 to rapidly identify SHO1 variants.

  • Express and characterize different SHO1 variants to determine functional differences.

  • Assess whether specific SHO1 variants correlate with differences in virulence or host range.

Understanding this diversity can provide insights into adaptation mechanisms and potentially explain regional differences in pathogenicity.

How does SHO1 interact with other virulence factors like SAD1?

The effector SUPPRESSOR OF APICAL DOMINANCE1 (SAD1) changes the development of female inflorescences in S. reilianum-infected maize . To investigate potential interactions between SHO1 and effectors like SAD1:

  • Perform co-expression analysis to identify temporal correlation between SHO1 and effector expression.

  • Use protein-protein interaction screens to test for direct interactions.

  • Create double mutants (SHO1-deficient and SAD1-deficient) to look for epistatic relationships.

  • Analyze signaling pathway crosstalk through phosphoproteomic analysis.

  • Test whether osmotic stress conditions affect effector production or secretion in wild-type versus SHO1-deficient strains.

This research could reveal how environmental sensing through SHO1 coordinates with effector-mediated virulence strategies.

What are the common difficulties in SHO1 expression and purification, and how can they be addressed?

Researchers often encounter these challenges when working with recombinant SHO1:

ChallengePotential Solution
Poor expression levelsOptimize codon usage for expression host; test different expression tags
Protein insolubilityExpress at lower temperatures (16°C); include osmolytes in buffers
Degradation during purificationAdd protease inhibitors; reduce purification time; keep samples cold
Loss of function after purificationInclude stabilizing agents in buffer; verify protein folding with CD spectroscopy
Non-specific binding during affinity purificationIncrease imidazole in wash buffers; add low concentrations of detergents

When working with His-tagged SHO1 , be particularly attentive to imidazole concentrations during elution from Ni-NTA columns, as premature elution or excessive binding can significantly affect yield and purity.

How should researchers interpret contradictory results in SHO1 functional studies?

When facing contradictory results:

  • Verify the genetic background of the S. reilianum strains used, considering potential mitotype differences similar to those observed in cox1 .

  • Examine experimental conditions, particularly osmolarity levels, as small differences can significantly impact SHO1 behavior.

  • Consider post-translational modifications that might affect protein function and could vary between experimental systems.

  • Test functionality in different genetic backgrounds, including hybrid systems like rUSH , to identify strain-specific effects.

  • Validate key findings using multiple independent techniques rather than relying on a single experimental approach.

Document experimental conditions meticulously, as SHO1's osmosensing function makes it particularly sensitive to environmental parameters.

What emerging technologies will advance our understanding of SHO1 function?

Several cutting-edge approaches show promise for SHO1 research:

  • Cryo-electron microscopy for high-resolution structural analysis of SHO1 in different activation states

  • Optogenetic tools to control SHO1 signaling with light, allowing precise temporal manipulation

  • Single-cell transcriptomics to examine cell-to-cell variability in SHO1-mediated responses

  • Genome-wide CRISPR screens to identify genes that interact with SHO1 pathways

  • Synthetic biology approaches to engineer modified SHO1 proteins with novel functions or altered specificity

These technologies could help elucidate the mechanistic details of SHO1's role in osmosensing and pathogenicity.

How might understanding SHO1 contribute to broader fungal biology and pathogenesis research?

Research on SHO1 has implications beyond S. reilianum:

  • Comparative studies across fungal pathogens could reveal conserved mechanisms of environmental sensing critical for infection.

  • Insights into SHO1-mediated osmosensing might explain adaptation to different ecological niches and host ranges.

  • Understanding signaling networks involving SHO1 could identify targets for broad-spectrum antifungal strategies.

  • Methodologies developed for studying recombinant SHO1 can be applied to other membrane-associated signaling proteins.

  • The creation of interspecific hybrids like rUSH provides a novel platform for studying functional conservation and divergence of signaling pathways across fungal species.

By situating SHO1 research within this broader context, researchers can contribute to fundamental advances in understanding fungal biology and host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.