Recombinant Sporulation membrane protein ytrH (ytrH)

Shipped with Ice Packs
In Stock

Description

Introduction to Sporulation Membrane Protein YtrH

Sporulation membrane protein ytrH (ytrH) is a protein encoded by the ytrH gene in Bacillus subtilis. It is classified as a sigma(E)-controlled gene, making it part of a significant regulon of 262 genes directed by the transcription factor sigma(E) during the sporulation process . Despite the large number of genes in this regulon, only a small fraction of mutations in these genes severely impair sporulation, suggesting complex regulatory relationships and potential functional redundancies among these genes .

The ytrH protein is also known by several synonyms including spoVIGA and BSU29239, and is identified in the UniProt database with the accession number C0H3P8 . As a membrane protein involved in sporulation, ytrH appears to play a specialized role in the formation of bacterial endospores, a process critical for bacterial survival under unfavorable environmental conditions.

Physical and Biochemical Properties

For research and commercial purposes, recombinant ytrH protein is typically produced with additional features to facilitate purification and detection. The table below summarizes the key properties of commercially available Recombinant Sporulation membrane protein ytrH:

PropertyDescription
Species OriginBacillus subtilis
Expression SystemE. coli
TagN-terminal His tag
Protein LengthFull Length (1-113 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage FormTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C, avoiding repeated freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol for long-term storage
UniProt IDC0H3P8

Sporulation Pathway Involvement

The ytrH protein plays a specific role in the complex process of bacterial sporulation, particularly in Bacillus subtilis. As part of the sigma(E) regulon, ytrH is expressed during the early stages of sporulation when the forespore is being engulfed by the mother cell . Research has demonstrated that while null mutations in ytrH alone cause only a mild defect in sporulation (2- to 10-fold reduction in efficiency), its importance becomes more apparent when combined with mutations in other sporulation genes .

Genetic Interaction Studies

One of the most significant findings regarding ytrH comes from genetic interaction studies examining the effects of multiple mutations. Research has revealed strong synthetic sporulation phenotypes when mutations in ytrH are combined with mutations in other genes, particularly ybaN . The double mutant of ybaN and ytrH showed dramatically reduced sporulation efficiency, with rates more than 10,000-fold lower than the wild type .

Thin-section electron microscopy revealed that this ybaN ytrH double mutant exhibits a specific block in cortex formation during sporulation . These findings support the hypothesis that ytrH functions in pathways related to spore cortex development, a critical layer of the spore that provides resistance to environmental stresses.

Functional Redundancy in Sporulation

An important insight from studies involving ytrH is the concept of functional redundancy within sporulation pathways. The fact that individual mutations in sigma(E)-controlled genes like ytrH produce only mild defects, while certain combinations cause severe impairment, suggests the existence of multiple parallel or partially overlapping pathways that can compensate for each other . This redundancy may have evolved to ensure the robustness of the sporulation process, which is critical for bacterial survival.

As noted in research findings, "The existence of otherwise hidden sporulation pathways indicates that functional redundancy may mask the role of hitherto unrecognized sporulation genes" . This observation highlights the importance of studying protein interactions rather than focusing solely on individual gene functions.

Recombinant Production Methods

The recombinant ytrH protein is typically produced using E. coli expression systems with an N-terminal histidine tag to facilitate purification . This approach allows for the production of high-purity protein suitable for various research applications. The recombinant protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

For optimal use in research applications, specific storage and reconstitution protocols are recommended:

  • Storage at -20°C/-80°C upon receipt

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (final concentration of 5-50%) for long-term storage

Research Applications

Recombinant ytrH protein serves various research purposes, particularly in studies focused on:

  1. Bacterial sporulation mechanisms

  2. Spore cortex formation

  3. Protein-protein interactions within sporulation pathways

  4. Functional genomics of Bacillus subtilis

  5. Development of antimicrobial strategies targeting sporulation

The availability of purified recombinant protein facilitates biochemical studies, including interaction analyses, structural determinations, and functional assays that would be difficult to perform using endogenous protein from bacterial sources.

Interaction Network Mapping

Given the evidence for functional redundancy and genetic interactions involving ytrH, comprehensive mapping of its protein interaction network would significantly advance our understanding of its role in sporulation. Techniques such as affinity purification coupled with mass spectrometry could identify binding partners and functional complexes involving ytrH.

Antimicrobial Development

The critical role of sporulation in bacterial persistence suggests that proteins involved in this process, including ytrH, might serve as targets for novel antimicrobial compounds. Targeting sporulation-specific proteins could lead to strategies that prevent spore formation without affecting vegetative growth, potentially reducing the development of resistance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. If you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will identify the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ytrH; spoVIGA; BSU29239; Sporulation membrane protein YtrH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytrH
Target Protein Sequence
MDQEAGFMVNFINSYFIALGVLIGGALIGGLGAYLAGEPPLTAITKLANRLKIWALVAAI GGTFDAVYSFERGILEGNTRDIFKQLLLIISAMGGAQSGWLIISWLTQEHLSS
Uniprot No.

Target Background

Function
YtrH is a sporulation membrane protein that plays a role in sporulation. It may contribute to cortex formation or stability.
Database Links
Subcellular Location
Forespore outer membrane; Multi-pass membrane protein.

Q&A

What is ytrH and what is its role in bacterial sporulation?

ytrH is a membrane protein encoded by the ytrHI operon in Bacillus subtilis that plays a critical role in the sporulation process. While single mutations in ytrH cause only mild sporulation defects (approximately 11% reduction in sporulation efficiency compared to wild type), its function becomes particularly evident when combined with mutations in other sporulation genes .

The protein appears to be involved in cortex formation during spore development, as electron microscopy studies of double mutants have revealed. Most notably, when ytrH mutation is combined with mutation of the ybaN gene, sporulation efficiency drops by more than 10,000-fold compared to wild type, indicating a critical synergistic relationship between these genes .

How is ytrH expressed and regulated during sporulation?

ytrH expression is controlled by the transcription factor σE, which is activated specifically in the mother cell compartment during the intermediate stages of sporulation. This sigma factor directs the expression of a regulon containing 262 genes, including the ytrHI operon .

The temporal expression pattern of ytrH follows the activation of σE, which occurs after asymmetric division and continues through the engulfment stage of sporulation. This timing aligns with ytrH's apparent role in cortex formation, which begins after engulfment is complete.

Table 1: Sporulation Efficiency of Wild Type and Mutant Strains

GenotypeSporulation Efficiency (relative to wild type)
Wild Type1.0
ytrH0.11
ytrI0.14
ybaN0.12
ybaN ytrH<0.0001
ybaN ytrI<0.0001

What is the genetic organization of the ytrHI operon?

The ytrHI operon in B. subtilis consists of two genes: ytrH and ytrI. In this operon structure, ytrH is located upstream of ytrI, and both genes are co-transcribed from a common promoter that is recognized by σE . This genetic arrangement is significant for research design, as mutations in ytrH can potentially have polar effects on ytrI expression.

Complementation studies have demonstrated that the severe sporulation defect in the ybaN ytrH double mutant cannot be rescued by expressing only ytrI at a secondary locus (amyE), confirming that ytrH has independent functions beyond potentially regulating ytrI . Similarly, the mild sporulation defect of a deletion of the entire ytrHI operon was alleviated by the presence of a copy of the complete operon at the amyE locus, but not by ytrI alone.

What are the recommended methods for creating and verifying ytrH knockout mutants?

When creating ytrH knockout mutants, researchers should consider several methodological approaches:

  • Gene Replacement Strategy: Replace the ytrH coding sequence with an antibiotic resistance marker through homologous recombination. This approach should be designed to minimize polar effects on downstream ytrI, potentially by including an outward-facing promoter after the resistance marker.

  • Clean Deletion Method: Use a marker-removal system (such as Cre-lox) to create clean deletions that don't disrupt the reading frame or introduce polar effects.

  • Verification Protocols:

    • PCR verification with primers flanking the deletion site

    • Sequencing to confirm the exact nature of the modification

    • RT-PCR to verify the absence of ytrH transcript

    • Western blotting with anti-ytrH antibodies (if available)

    • Complementation tests to confirm phenotype rescue

  • Control Construction: Create both single gene knockouts (ytrH, ytrI) and operon deletions (ytrHI) to distinguish individual gene functions .

How should researchers assess sporulation efficiency in ytrH mutants?

The assessment of sporulation efficiency in ytrH mutants should employ multiple complementary approaches:

  • Quantitative Sporulation Assays:

    • Heat resistance test (80°C for 20 minutes) followed by plating on nutritive media to count viable spores

    • Lysozyme resistance test to verify proper cortex formation

    • Comparison of total cell counts (by microscopy or OD) to heat-resistant spore counts

  • Microscopic Evaluation:

    • Phase-contrast microscopy to identify phase-bright (mature) and phase-dark (immature) spores

    • Fluorescence microscopy with membrane staining (e.g., FM1-43) to assess asymmetric division and engulfment

    • Transmission electron microscopy to examine spore ultrastructure, particularly cortex formation

  • Biochemical Markers:

    • Dipicolinic acid (DPA) accumulation as a marker of late sporulation

    • Alkaline phosphatase activity as a marker of early sporulation events

    • Muramic acid accumulation to assess peptidoglycan synthesis during cortex formation

What experimental designs can identify functional redundancy between ytrH and other genes?

To identify functional redundancy between ytrH and other sporulation genes, researchers should employ the following experimental approaches:

  • Systematic Double Mutant Creation: Generate double mutants of ytrH with other σE-controlled genes, particularly those with mild individual sporulation phenotypes. A comprehensive approach would test all pairwise combinations .

  • Synergy Assessment: Define synergy quantitatively as a sporulation efficiency that is ≥10-fold lower for a double mutant than would be predicted by the simple product of the single mutant efficiencies . For example:

    • If ytrH single mutant has 0.11 efficiency

    • And gene X has 0.5 efficiency

    • Expected combined effect: 0.11 × 0.5 = 0.055

    • Synergistic effect would be < 0.0055

  • Complementation Analysis: Test if the phenotype of double mutants can be rescued by expressing either gene from an ectopic locus (e.g., amyE), which helps distinguish between direct functional redundancy and indirect interactions .

  • Operon Reconstruction Experiments: For genes in operons, like ytrH and ytrI, reconstruct partial operons to determine which components are essential for complementation, helping to identify functional units .

How should researchers interpret synergistic effects between ytrH and other mutations?

Interpreting synergistic effects between ytrH and other mutations requires careful analysis:

  • Quantitative Assessment: Calculate the expected multiplicative effect of combined mutations and compare to observed values. A synergistic effect is typically defined as a sporulation efficiency that is ≥10-fold lower for a double mutant than the product of the individual mutant efficiencies .

  • Pathway Analysis: Strong synergistic effects often indicate that genes function in parallel pathways that converge on the same essential process. For example, the strong synergy between ybaN and ytrH (>10,000-fold defect) suggests they function in distinct but complementary pathways critical for cortex formation .

  • Temporal Considerations: Analyze when the synergistic defect becomes apparent during the sporulation process. For example, electron microscopy revealed that the ybaN ytrH double mutant is blocked at engulfment, prior to cortex synthesis .

  • Biochemical Evidence: Examine biochemical markers like DPA accumulation and muramic acid levels to determine precisely which aspects of spore development are affected in synergistic interactions .

Table 2: Synergistic Effects Between ytrH and Other Sporulation Genes

Mutation PairPredicted Efficiency*Actual EfficiencySynergistic Effect†
ytrH ytrI0.020.050.4
ybaN ytrH~0.013<0.0001>100
ybaN ytrI~0.017<0.0001>100

*Predicted efficiency calculated as the product of individual mutation efficiencies
†Ratio of predicted to actual efficiency values; >10 indicates significant synergy

What methods are appropriate for quantifying cortex formation defects in ytrH mutants?

To accurately quantify cortex formation defects in ytrH mutants, researchers should employ multiple complementary techniques:

  • Electron Microscopy Analysis:

    • Thin-section electron microscopy to visualize cortex thickness and structure

    • Quantitative measurements of cortex dimensions across multiple samples

    • Assessment of cortex uniformity and structural integrity

  • Biochemical Quantification:

    • Muramic acid analysis to measure peptidoglycan accumulation

    • Determination of muramic acid derivatives specific to spore cortex (muramic-δ-lactam)

    • Time-course measurements to track cortex synthesis dynamics

  • Functional Assessments:

    • Heat resistance tests correlated with cortex formation

    • Lysozyme sensitivity assays (properly formed cortex confers lysozyme resistance)

    • DPA retention measurements (cortex defects often lead to DPA leakage)

  • Molecular Probes:

    • Fluorescent D-amino acid incorporation to visualize peptidoglycan synthesis in vivo

    • Immunofluorescence with cortex-specific antibodies

    • Fluorescent wheat germ agglutinin staining to visualize peptidoglycan

How can researchers distinguish between direct and indirect effects of ytrH mutation?

Distinguishing between direct and indirect effects of ytrH mutation requires careful experimental design:

  • Complementation Analysis:

    • Express wild-type ytrH from an inducible promoter at different timepoints to determine when ytrH function is required

    • Test if ytrH expression can rescue the phenotype after the normal time of expression

    • Express ytrH in different cellular compartments to determine where it functions

  • Protein Localization Studies:

    • Create fluorescent protein fusions to determine where and when YtrH localizes during sporulation

    • Use immunogold electron microscopy to precisely locate YtrH at the ultrastructural level

    • Correlate YtrH localization with the timing of cortex formation

  • Protein-Protein Interaction Analysis:

    • Perform bacterial two-hybrid or co-immunoprecipitation studies to identify direct interaction partners

    • Conduct synthetic lethal screens to identify genes that become essential in a ytrH mutant background

    • Compare the interaction networks of YtrH with those of YtrI to distinguish unique functions

  • Molecular Function Analysis:

    • Perform domain mapping to identify functional regions of YtrH

    • Test enzymatic activities associated with peptidoglycan synthesis

    • Create point mutations in conserved residues to identify essential amino acids

What are the mechanistic models for how ytrH contributes to cortex formation?

Several mechanistic models can explain how ytrH contributes to cortex formation, each with specific testable predictions:

  • Peptidoglycan Precursor Transport Model: YtrH may function as a membrane transporter that facilitates the movement of peptidoglycan precursors across the inner forespore membrane. This model predicts that:

    • YtrH localizes to the inner forespore membrane

    • YtrH mutants show accumulation of peptidoglycan precursors in the mother cell

    • YtrH has structural features consistent with transport proteins

  • Cortex Enzyme Regulation Model: YtrH may regulate enzymes involved in cortex synthesis. This model predicts that:

    • YtrH interacts directly with known cortex synthesis enzymes

    • Overexpression of certain cortex enzymes might bypass the need for YtrH

    • YtrH mutants show altered patterns of enzyme localization

  • Structural Scaffold Model: YtrH may serve as a scaffold that organizes cortex synthesis machinery. This model predicts that:

    • YtrH forms multimeric complexes at the forespore membrane

    • Multiple cortex synthesis proteins co-localize with YtrH

    • Mutations in protein-interaction domains of YtrH disrupt cortex formation

  • Membrane Environment Model: YtrH may modify the membrane environment to facilitate cortex synthesis. This model predicts that:

    • YtrH affects membrane fluidity or composition

    • Lipid analysis shows differences in forespore membranes of ytrH mutants

    • Membrane-modifying agents might partially rescue ytrH mutant phenotypes

How can researchers investigate potential stress responses triggered by ytrH mutation?

To investigate stress responses triggered by ytrH mutation, researchers should employ comprehensive approaches:

  • Transcriptomic Analysis:

    • RNA-seq comparing wild-type and ytrH mutant strains during sporulation

    • Time-course analysis to identify primary vs. secondary transcriptional responses

    • Comparison with known stress response signatures to identify specific pathways activated

  • Metabolomic Profiling:

    • Targeted analysis of stress-related metabolites (e.g., reactive oxygen species)

    • Measurement of energy metabolites to assess energetic stress

    • Analysis of cell wall precursors to identify potential feedback mechanisms

  • Genetic Suppressor Screens:

    • Identify mutations that suppress the ytrH phenotype

    • Screen for extragenic suppressors to identify compensatory pathways

    • Test if inactivation of specific stress response pathways exacerbates the ytrH phenotype

  • Microscopic Stress Indicators:

    • Membrane potential measurements to assess envelope stress

    • Cell shape and morphology analysis during sporulation

    • Assessment of protein aggregation and inclusion body formation

What evolutionary insights can be gained from comparative analysis of ytrH across Bacillus species?

Comparative analysis of ytrH across Bacillus species can provide valuable evolutionary insights:

  • Phylogenetic Distribution Analysis:

    • Survey the presence/absence of ytrH homologs across diverse Bacillus species

    • Correlate the presence of ytrH with sporulation efficiency and ecological niches

    • Identify species with multiple ytrH paralogs that might indicate functional specialization

  • Sequence Conservation Patterns:

    • Analyze selection pressures on different domains of YtrH

    • Identify highly conserved residues likely essential for function

    • Detect co-evolution patterns between YtrH and interaction partners

  • Comparative Genomic Context:

    • Compare the operonic structure of ytrH across species

    • Identify consistently co-localized genes that may function together

    • Detect horizontal gene transfer events involving ytrH

  • Experimental Validation:

    • Test complementation of B. subtilis ytrH mutants with orthologs from diverse species

    • Compare phenotypic effects of ytrH mutation across multiple Bacillus species

    • Create chimeric YtrH proteins to map species-specific functional domains

This comparative approach can reveal how ytrH function has been conserved or diversified during Bacillus evolution, potentially identifying specialized adaptations in different ecological contexts.

What are the most significant technical challenges in studying ytrH function?

Researchers investigating ytrH function face several significant technical challenges:

  • Functional Redundancy: The mild phenotype of single ytrH mutants suggests functional redundancy with other sporulation genes, requiring systematic double mutant analysis to reveal its full importance .

  • Temporal Control: The function of ytrH in sporulation occurs during specific developmental stages, requiring precise temporal control of gene expression in complementation experiments.

  • Membrane Protein Analysis: As a membrane protein, YtrH presents challenges for purification, structural analysis, and biochemical characterization. Specialized techniques for membrane protein solubilization and stabilization may be required.

  • Pleiotropic Effects: Distinguishing direct effects of ytrH mutation from secondary consequences requires careful experimental design and multiple lines of evidence.

  • Sporulation Heterogeneity: Natural heterogeneity in sporulation efficiency within populations can complicate phenotypic analysis, requiring large sample sizes and multiple analytical approaches.

How can researchers optimize protein expression systems for recombinant YtrH production?

For optimal recombinant YtrH production, researchers should consider:

  • Expression System Selection:

    • Bacterial systems: Modified B. subtilis strains may provide the most natural environment

    • E. coli systems: C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Cell-free systems: May allow production without membrane insertion constraints

  • Protein Engineering Strategies:

    • Fusion tags: MBP, SUMO, or Mistic fusions to enhance solubility

    • Truncation constructs: Removal of challenging domains while preserving function

    • Thermostabilizing mutations: Introduction of mutations that enhance stability

  • Expression Optimization:

    • Codon optimization for the chosen expression host

    • Induction conditions: Lower temperatures (16-20°C) and mild inducers

    • Specialized media formulations with osmolytes or membrane-stabilizing agents

  • Purification Considerations:

    • Detergent screening to identify optimal solubilization conditions

    • Native nanodiscs or styrene maleic acid lipid particles (SMALPs) for membrane extraction

    • On-column detergent exchange during purification

  • Quality Control:

    • Size-exclusion chromatography to assess homogeneity

    • Circular dichroism to verify proper folding

    • Functional assays to confirm biological activity

What are the recommended controls for interpreting ytrH microscopy data?

When conducting microscopy studies of ytrH mutants, researchers should implement the following controls:

  • Strain Controls:

    • Wild-type B. subtilis (positive control)

    • Known cortex-defective mutants (comparative controls)

    • ytrI single mutant to distinguish effects from the operon partner

    • Complemented ytrH mutant to verify phenotype rescue

  • Temporal Controls:

    • Time-course analysis covering pre-sporulation through mature spore release

    • Synchronized sporulation cultures to reduce heterogeneity

    • Parallel tracking of sporulation markers (e.g., σG activity, DPA accumulation)

  • Technical Controls:

    • Multiple fixation methods to identify potential artifacts

    • Z-stack imaging to ensure complete structural visualization

    • Blinded analysis to prevent observer bias in phenotype assessment

  • Quantification Controls:

    • Multiple biological and technical replicates (minimum n=3)

    • Automated image analysis algorithms to ensure consistent measurements

    • Statistical comparison methods appropriate for the data distribution

  • Labeling Controls:

    • Secondary antibody-only controls for immunofluorescence

    • Competing peptide controls to verify antibody specificity

    • Morphological markers to confirm sporulation stages

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.