Recombinant Spring viremia of carp virus Glycoprotein G (G)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
G; Glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-509
Protein Length
Full Length of Mature Protein
Species
Spring viremia of carp virus (Rhabdovirus carpia)
Target Names
G
Target Protein Sequence
IPIFVPSGRNISWQPVIQPFDYQCPIHGNLPNTMGLSATKLTIKSPSVFSTDKVSGWICH AAEWKTTCDYRWYGPQYITHSIHPISPTIDECRRIIQRIASGTDEDLGFPPQSCGWASVT TVSNTNYRVVPHSVHLEPYGGHWIDHEFNGGECREKVCEMKGNHSIWITEETVQHECAKH IEEVEGIMYGNVPRGDVMYANNFIIDRHHRVYRFGGSCQMKFCNKDGIKFARGDWVEKTA GTLTTIHDNVPKCVDGTLVSGHRPGLDLIDTVFNLENVVEYTLCEGTKRKINKQEKLTSV DLSYLAPRIGGFGSVFRVRNGTLERGSTTYIRIEVEGPIVDSLNGTDPRTNASRVFWDDW ELDGNIYQGFNGVYKGKDGKIHIPLNMIESGIIDDELQHAFQTDIIPHPHYDDDEIREDD IFFDNTGENGNPVDAVVEWVSGWGTSLKFFGMTLVALILIFLLIRCCVACTYLMKRSKRP ATESHEMRSLV
Uniprot No.

Target Background

Function

This glycoprotein mediates viral attachment to host cell receptors, triggering clathrin-mediated endocytosis of the virion. The ensuing acidic pH within the endosome induces conformational changes in the glycoprotein trimer, resulting in fusion between the viral and endosomal membranes.

Protein Families
Vesiculovirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host membrane; Single-pass type I membrane protein.

Q&A

What is the molecular structure and function of SVCV Glycoprotein G?

SVCV Glycoprotein G is a major viral surface protein with a molecular weight of approximately 66 kDa when expressed in insect cells . As the primary envelope glycoprotein, SVCV G protein performs several essential functions:

  • Mediates viral attachment to host cell receptors

  • Facilitates membrane fusion during viral entry

  • Enables cell-to-cell spread of the virus

  • Serves as the major viral antigen that elicits host immune responses

Structurally, SVCV G forms part of the viral genome organization (N-P-M-G-L) characteristic of rhabdoviruses. The G protein gene encodes a single polypeptide that undergoes post-translational modifications including glycosylation . The mature protein forms trimeric spikes on the viral surface that undergo pH-dependent conformational changes essential for membrane fusion during viral entry.

How does SVCV Glycoprotein G compare with glycoproteins from other rhabdoviruses?

SVCV G protein shares structural and functional similarities with other rhabdovirus glycoproteins, particularly with vesicular stomatitis virus (VSV) G protein . Key comparative features include:

FeatureSVCV G ProteinVSV G Protein
Molecular Weight~66 kDa~65 kDa
Cell Fusion ActivityMore severe cell fusionLess severe cell fusion
Role in Viral EntryEssentialEssential
Antigenic PropertiesMajor immunogenMajor immunogen

Comparative analysis has demonstrated that while both proteins mediate cell fusion, SVCV G protein induces more pronounced fusion of insect cells compared to VSV G protein . This suggests potential differences in fusion mechanisms or kinetics that may influence viral infectivity and pathogenesis.

What role does SVCV Glycoprotein G play in viral pathogenesis?

SVCV G protein is instrumental in multiple aspects of viral pathogenesis:

  • Host Cell Entry: G protein mediates attachment to cellular receptors and subsequent fusion of viral and cellular membranes, enabling virus entry into host cells .

  • Tissue Tropism: Recent studies using recombinant SVCV expressing fluorescent proteins have identified fish fins as primary initial infection sites in both zebrafish and carp, suggesting G protein interactions with specific receptors determine infection routes .

  • Immune Response Modulation: The G protein triggers immune responses including neutrophil recruitment and inflammation that may contribute to tissue damage and disease progression .

  • Cell-to-Cell Spread: The fusion activity of G protein facilitates direct virus spread between adjacent cells, potentially bypassing neutralizing antibodies .

Understanding these pathogenic mechanisms is essential for developing effective control strategies against SVCV.

What expression systems are optimal for producing functional recombinant SVCV Glycoprotein G?

Several expression systems have been utilized for SVCV G protein production, each with distinct advantages for research applications:

Expression SystemAdvantagesApplicationsResearch Evidence
Baculovirus/Insect CellsProper folding; Post-translational modifications; Surface expressionFunctional studies; Vaccine developmentSuccessfully expressed under p10 promoter with confirmed surface localization
Bacterial SystemsCost-effective; Rapid productionAntigen production; Antibody generationLimited by lack of post-translational modifications
Mammalian Cell ExpressionNative-like modificationsReceptor binding studiesProvides most authentic protein form
Lactobacillus plantarumSurface display; Oral delivery potentialVaccine candidatesDemonstrated efficacy as oral vaccine vector

For functional studies, the baculovirus/insect cell system has proven particularly effective. This approach allows for proper folding, post-translational modifications, and cell surface expression of SVCV G protein . Research demonstrates that when the SVCV G gene is inserted into the baculovirus genome under the control of the p10 promoter, the expressed protein correctly localizes to the cell surface and maintains fusion activity .

Methodological considerations include:

  • Codon optimization for the expression system

  • Inclusion of appropriate signal sequences

  • Selection of promoters for optimal expression levels

  • Verification of proper folding and glycosylation

  • Assessment of functional activity through cell fusion assays

How can the functionality of recombinant SVCV Glycoprotein G be assessed in vitro?

Several complementary methodologies can evaluate the functionality of recombinant SVCV G protein:

  • Cell Fusion Assays:

    • Seed SVCV G-expressing cells and monitor syncytia formation

    • Apply pH changes to trigger fusion activity

    • Quantify fusion events through microscopy

    • Compare fusion efficiency with controls (e.g., VSV G)

    • Research shows SVCV G mediates more severe insect cell fusion than VSV G

  • Immunofluorescence Analysis:

    • Use indirect immunofluorescence to confirm surface expression

    • Apply anti-SVCV G antibodies followed by fluorescent secondary antibodies

    • Perform confocal microscopy to assess subcellular localization

    • This approach has successfully detected SVCV G on infected insect cell surfaces

  • Western Blot Analysis:

    • Confirm protein size (approximately 66 kDa for insect cell-expressed G protein)

    • Assess glycosylation status and post-translational modifications

    • Evaluate oligomeric states under different conditions

    • Western blot analysis has demonstrated the expected size of SVCV G in previous studies

  • Interaction Studies:

    • Perform tandem affinity purification to identify host protein interactions

    • Use mass spectrometry to characterize binding partners

    • Conduct immunoprecipitation to confirm specific interactions

    • This methodology identified HSC70 as an interaction partner of SVCV G protein

These complementary approaches provide multifaceted assessment of recombinant SVCV G protein functionality and interactions.

What methodological approaches effectively identify host proteins interacting with SVCV Glycoprotein G?

Investigating SVCV G protein-host interactions requires systematic approaches:

  • Tandem Affinity Purification (TAP):

    • Express tagged SVCV G protein in relevant cell lines

    • Perform sequential purification steps via affinity tags

    • Isolate protein complexes containing G protein and interacting partners

    • This approach successfully identified HSC70 as a G protein interaction partner

  • Mass Spectrometry Analysis (LC-MS/MS):

    • Process purified protein complexes for proteomic analysis

    • Identify peptide fragments from G protein and associated proteins

    • Compare against protein databases to identify interacting partners

    • This technique confirmed HSC70-G protein interaction

  • Co-immunoprecipitation:

    • Use anti-G protein antibodies to pull down protein complexes

    • Identify co-precipitated host proteins via Western blot

    • Verify specific interactions through reciprocal co-immunoprecipitation

    • This method validated the interaction between SVCV G and HSC70

  • Confocal Microscopy:

    • Visualize co-localization of G protein with host factors

    • Use fluorescently labeled antibodies or fusion proteins

    • Quantify spatial overlap in different cellular compartments

    • This technique provided visual confirmation of protein co-localization

These methodologies revealed that HSC70 physically interacts with SVCV G protein and mediates its lysosomal degradation, demonstrating how these approaches can uncover critical host-pathogen interactions .

What vaccine platforms utilizing SVCV Glycoprotein G show promise for fish immunization?

Multiple vaccine platforms utilizing SVCV G protein demonstrate varied efficacy profiles:

Vaccine PlatformAdministration RouteProtection LevelResearch Evidence
DNA VaccinesInjection (IM/IP)High (protection demonstrated in koi)Effective against North American SVCV strains
Recombinant L. plantarumOralModerate (53-71% protection)Demonstrated in both carp and koi species
Baculovirus-expressed GVarious (potential)Promising (based on functional expression)Speculative potential based on expression studies
Viral Vector VaccinesInjectionVariable (research ongoing)Mentioned in comparative studies

The DNA vaccine approach has demonstrated effectiveness against North American SVCV strains in ornamental koi . Meanwhile, oral vaccination using recombinant L. plantarum co-expressing SVCV G protein and KHV ORF81 protein induced significant levels of immunoglobulin M (IgM) and provided protection rates of 71% in vaccinated carps and 53% in vaccinated koi at 65 days post-challenge .

Future research directions include:

  • Optimization of antigen presentation in various platforms

  • Development of temperature-stable formulations

  • Combination approaches for broader protection

  • Mass vaccination strategies suitable for aquaculture settings

How does oral delivery of SVCV Glycoprotein G compare to injection methods for fish immunization?

Comparison between oral and injection vaccine delivery methods reveals important differences:

ParameterOral DeliveryInjection Delivery
Protection RateModerate (53-71%) Higher (reported for DNA vaccines)
Antibody ResponseDetectable IgM levels Typically stronger systemic response
Practicality for Mass VaccinationHighly practicalLabor-intensive
Stress to FishMinimalSignificant handling stress
Application in AquacultureMore feasible for large populationsChallenging for large-scale use

Recombinant L. plantarum expressing SVCV G protein has demonstrated efficacy as an oral vaccine, with research showing significant induction of immunoglobulin M (IgM) and reduced viral loads after challenge . This approach resulted in protection rates of 71% in vaccinated carps and 53% in vaccinated koi up to 65 days post-challenge .

Methodological considerations for oral vaccine development include:

  • Formulation to protect antigens during gastrointestinal transit

  • Dosage optimization for sufficient antigen delivery

  • Boosting strategies to enhance duration of protection

  • Adjuvant incorporation to improve immune responses

While injection methods typically generate stronger systemic immunity, oral vaccination offers practical advantages for mass immunization in aquaculture settings, particularly for juvenile fish that are most susceptible to SVCV infection .

What immunological parameters indicate successful vaccination against SVCV?

Effective assessment of SVCV vaccine efficacy requires monitoring multiple immunological parameters:

  • Antibody Responses:

    • Measurement of SVCV-specific IgM levels using ELISA

    • Neutralizing antibody titers through serum neutralization tests

    • Mucosal antibody detection in skin and gill mucus

    • Research shows significant IgM induction following vaccination with recombinant L. plantarum expressing SVCV G protein

  • Cellular Immunity Markers:

    • T-cell proliferation in response to SVCV antigens

    • Cytokine expression profiles (pro-inflammatory vs. antiviral)

    • Cytotoxic activity against SVCV-infected cells

  • Protection Parameters:

    • Survival rates following controlled challenge

    • Reduction in viral loads quantified by PCR

    • Histopathological assessment of tissue damage

    • Studies demonstrate protection rates of 53-71% and reduced viral loads in vaccinated fish

  • Long-term Immunity Indicators:

    • Duration of antibody persistence

    • Memory B and T cell responses

    • Protection against heterologous SVCV strains

An effective vaccination approach should ideally elicit both humoral and cell-mediated immunity while providing durable protection across various environmental conditions, particularly at the lower temperatures (10-17°C) associated with SVCV outbreaks .

How do host cellular factors regulate SVCV Glycoprotein G expression and function?

Research has identified key host factors that regulate SVCV G protein:

  • HSC70 (Heat shock cognate protein 70):

    • Directly interacts with SVCV G protein

    • Overexpression dramatically inhibits SVCV replication

    • Loss of function enhances viral replication

    • Mediates lysosomal degradation of ubiquitinated SVCV G protein

    • Represents a cellular antiviral defense mechanism

  • MARCH8 (Membrane-associated RING-CH 8):

    • Functions as an E3 ubiquitin ligase

    • Critical for SVCV G protein ubiquitylation

    • Leads to G protein lysosomal degradation

    • Works in conjunction with HSC70

  • Lysosomal Degradation Pathway:

    • Primary route for regulated degradation of SVCV G protein

    • Ubiquitination serves as the targeting signal

    • Reduces G protein availability for virion assembly

    • Represents a host defense strategy against SVCV

The mechanism involves HSC70 interaction with SVCV G protein, facilitating MARCH8-mediated ubiquitination, which targets the protein for lysosomal degradation . This pathway represents an intrinsic cellular defense against SVCV infection, as evidenced by increased viral replication when HSC70 function is inhibited .

Understanding these regulatory mechanisms provides potential targets for antiviral strategies that could enhance natural host defense pathways.

What are the pathogenesis mechanisms of SVCV infection at the cellular and tissue level?

Recent in vivo studies using recombinant SVCV have revealed important insights into pathogenesis:

  • Initial Infection Sites:

    • Fish fins identified as primary initial infection sites in both zebrafish and carp

    • This tropism appears consistent across both model species and natural hosts

    • Suggests specific receptor distribution or barrier properties influencing entry

  • Immune Response Dynamics:

    • Neutrophil recruitment to infection sites

    • Persistent inflammation until death

    • Expression of pro-inflammatory cytokine IL1β

    • Tissue damage at initial replication sites

  • Route-Dependent Pathogenesis:

    • Bath immersion triggers persistent pro-inflammatory responses

    • Intravenous injection activates antiviral IFN signaling pathway

    • Highlights importance of infection route on disease progression

  • Cellular Damage Mechanisms:

    • Direct virus-induced injury to infected cells

    • Inflammatory damage from excessive immune activation

    • Progressive tissue destruction contributing to mortality

The fins as initial infection sites represent a key finding with implications for transmission dynamics and potential intervention strategies . Additionally, the observation that infection route significantly impacts immune response patterns highlights the importance of using appropriate infection models that mimic natural transmission when studying SVCV pathogenesis and evaluating vaccines .

How does SVCV Glycoprotein G contribute to viral immune evasion strategies?

While research on SVCV immune evasion is still emerging, several mechanisms involving G protein have been identified:

  • Cell-to-Cell Spread:

    • G protein-mediated cell fusion facilitates direct viral spread

    • May allow virus to bypass neutralizing antibodies

    • Creates syncytia that can protect replicating virus

  • Immune Response Modulation:

    • G protein interaction with host factors influences immune signaling

    • May potentially interfere with interferon responses

    • Bath immersion with SVCV induces inflammatory rather than antiviral responses

  • Unbalanced Inflammatory Response:

    • G protein triggers neutrophil recruitment and persistent inflammation

    • Leads to tissue damage rather than viral clearance

    • Contributes to disease pathology and mortality

  • Strain Variation:

    • Geographic variants of SVCV show G protein sequence diversity

    • May contribute to antigenic escape from previous immunity

    • Has implications for vaccine design and efficacy

Understanding these evasion strategies is critical for developing countermeasures, particularly vaccines that can overcome these mechanisms to provide robust protection.

What are the major obstacles in developing effective control measures against SVCV?

Several significant challenges remain in SVCV control:

  • Expanding Host Range:

    • Initially affecting cyprinids, SVCV has expanded to centrachid species (bluegill, largemouth bass)

    • First isolation from an amphibian species (salamander) occurred in 2015

    • Presents risk to native fish and amphibian populations in North America

  • Geographic Spread:

    • Formerly restricted to Europe and Asia

    • First North American detection in 2002, with subsequent outbreaks

    • At least nine detections/outbreaks in North America since initial case

  • Vaccination Challenges:

    • Mass vaccination in aquaculture settings remains logistically difficult

    • Temperature-dependent immune responses complicate vaccine efficacy

    • DNA vaccines show promise but face practical deployment issues

  • Limited Treatment Options:

    • No effective therapeutic treatments currently available

    • High mortality rates (up to 90%) in susceptible populations

    • Disease typically occurs at lower temperatures when fish immunity is compromised

  • Economic Impact:

    • Significant losses in both wild and farmed carp populations

    • Extensive eradication efforts required (135,000 fish euthanized in 2002 North Carolina outbreak)

    • Ongoing threat to aquaculture industry and native ecosystems

Addressing these challenges requires multifaceted approaches including improved surveillance, effective vaccines appropriate for mass deployment, and potential therapeutic interventions targeting viral or host factors.

What novel methodologies show promise for studying SVCV-host interactions?

Cutting-edge approaches are advancing SVCV research:

  • Reverse Genetics Systems:

    • Recently established for SVCV

    • Enables creation of recombinant SVCV expressing fluorescent or bioluminescent proteins

    • Allows precise tracking of viral infection and spread

    • Facilitates study of virus-host interactions using advanced imaging techniques

  • Zebrafish Infection Models:

    • Bath immersion of larvae with fluorescent recombinant SVCV

    • Visualization of initial replication sites

    • Assessment of innate immune responses using transgenic lines

    • Provides system for studying detailed pathophysiology

  • Multiscale Imaging Approaches:

    • In vivo visualization of infection progression

    • Tracking of host immune cell responses

    • Correlation with tissue damage and disease outcomes

    • Reveals new insights into SVCV infection dynamics

  • Molecular Interaction Studies:

    • Tandem affinity purification

    • Mass spectrometry analysis

    • Co-immunoprecipitation

    • Identifying key host factors like HSC70 that regulate viral replication

These methodologies have already yielded important discoveries, including the identification of fins as primary infection sites, the role of persistent neutrophil-driven inflammation in pathogenesis, and the importance of infection route on immune response patterns . They provide powerful tools for future investigations into SVCV pathogenesis and the development of control strategies.

What future vaccine strategies might improve protection against SVCV?

Emerging vaccine approaches show promise for enhanced SVCV protection:

  • Multivalent Oral Vaccines:

    • Co-expression of multiple viral antigens (e.g., SVCV G and KHV ORF81)

    • Demonstrated efficacy through significant IgM induction and reduced viral loads

    • Protection rates of 53-71% in vaccinated fish

    • Practical for mass vaccination in aquaculture settings

  • Expression System Optimization:

    • Baculovirus expression systems producing correctly folded G protein

    • Potential incorporation into viral envelopes for enhanced presentation

    • Specific promoter control (e.g., p10 promoter) for optimal expression

    • Demonstrated functionality through cell surface expression and fusion ability

  • Host Defense Enhancement:

    • Targeting HSC70-mediated viral degradation pathways

    • Enhancing natural antiviral mechanisms

    • Potential complementary approach to direct vaccination

    • Based on understanding of HSC70-SVCV G protein interactions

  • Route-Optimized Delivery Systems:

    • Bath immersion vaccines targeting identified initial infection sites (fins)

    • Mucosal immunity enhancement strategies

    • Consideration of infection route impact on immune response patterns

    • Informed by insights from in vivo infection studies

Advancing these approaches requires continued research into fundamental virus-host interactions, optimization of delivery systems, and field trials to assess real-world efficacy under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.