Recombinant Squalus acanthias Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)

Shipped with Ice Packs
In Stock

Description

Research Findings and Mutational Studies

Studies on Squalus acanthias KCNQ1 have elucidated its role in disease mechanisms and channel regulation:

  • Pathogenic Mutations:

    • The T587M mutation (threonine to methionine at position 587), identified in a Jervell and Lange-Nielsen (JLN) syndrome family, is conserved in Squalus acanthias, mice, and humans . This mutation disrupts channel function, leading to impaired cardiac repolarization and congenital deafness .

    • Frameshift mutations in the C-terminal domain (e.g., 20-bp deletions) are associated with truncated proteins and severe channel dysfunction, highlighting the structural importance of this region .

  • Regulatory Mechanisms:

    • PIP2 binding induces structural rearrangements in the channel’s pore domain, stabilizing an open conformation .

    • Co-assembly with KCNE subunits (e.g., KCNE3) modulates voltage sensitivity and rectification properties, enabling tissue-specific adaptations .

Applications in Biomedical Research

Recombinant Squalus acanthias KCNQ1 is utilized in multiple research contexts:

  • Cardiac Electrophysiology:

    • Used to study the molecular basis of long QT syndrome (LQTS) and atrial fibrillation. Mutations in conserved regions (e.g., R591H) mimic human arrhythmogenic variants .

    • Facilitates drug screening for KCNQ1 channel modulators, such as IKs enhancers for LQTS therapy .

  • Comparative Physiology:

    • Serves as a model for understanding evolutionary adaptations in voltage-gated potassium channels, particularly in marine species with unique electrolyte regulation needs .

Production and Technical Considerations

While recombinant Squalus acanthias KCNQ1 is not explicitly detailed in commercial databases, its production likely follows protocols established for homologs:

  • Expression Systems:

    • Typically expressed in E. coli or HEK293 cells with affinity tags (e.g., His-tag) for purification .

    • Requires lipid bilayers or liposomes for functional reconstitution, as demonstrated in human and porcine KCNQ1 studies .

  • Storage and Stability:

    ParameterRecommendation
    Storage Temperature-80°C for long-term
    Reconstitution BufferTris/PBS with 6% trehalose
    Purity>90% (SDS-PAGE verified)

Future Directions

Further research should focus on:

  • Cryo-EM structures of Squalus acanthias KCNQ1 to resolve PIP2- and CaM-binding interfaces.

  • High-throughput assays to identify species-specific pharmacological modulators.

  • Functional studies of C-terminal truncations to clarify their role in JLN syndrome .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNQ1; Potassium voltage-gated channel subfamily KQT member 1; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-660
Protein Length
full length protein
Species
Squalus acanthias (Spiny dogfish)
Target Names
KCNQ1
Target Protein Sequence
MSSEVKSRWSGSGSQKSGTARKPTMLEMAENAASRHYEPVPLPLQRSNSPDSSTDKNPES RAADSRAEVIINPDIPPKAIALPLSRYRGRNPFFSKVNIQGRTYNFLERPTGWKCFIYHF TVFLIVLVCLIFSVMSTIEQYHYFANRALVWMEIVLVVFFGTEYIVRLWSAGCRSKYVGF WGRLRFARKPISIIDLIVVVASVIVLCVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGT WRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDDSGSQQFGSYADALWWGV VTVTTIGYGDKVPQTWIGRTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQ IPAAASLIQTSWRCHAAENHESATWKMYVRQPTKFYVASPSPKTKKSVGKRKKLKTDKDN GLNSEKSLNVPNITYDHVVDKDDRKFENSNIDGYDSSVKKSLGILDVNSGALSRANSYAD DLDFIEGEPVLAPITHVSQLRESHRVTVKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYS QGHLNLMVRIKELQRRLDQSLGKPTMFLSVSEKSQDRGKNTIGARLNRVEEKFVHMDQKL NTITDMLHHLVAHQQGHPHPQTQPQAQGTVVQAVASTHSSLPSYEQLTVRRKDQDNQPDL
Uniprot No.

Target Background

Function
Potassium channel that plays a crucial role in various tissues, including the heart, inner ear, stomach, and colon. It associates with KCNE beta subunits, which modulate current kinetics. This channel induces a voltage-dependent potassium-selective outward current characterized by rapid activation and slow deactivation. It also promotes a delayed voltage-activated potassium current exhibiting outward rectification. During beta-adrenergic receptor stimulation, it participates in cardiac repolarization by associating with KCNE1 to form the I(Ks) cardiac potassium current, which increases the amplitude and slows down the activation kinetics of the outward potassium current I(Ks). When associated with KCNE3, it forms a potassium channel vital for cyclic AMP-stimulated intestinal secretion of chloride ions. In association with KCNE2, it forms a heterooligomer complex resulting in currents with seemingly instantaneous activation, rapid deactivation, a linear current-voltage relationship, and a reduction in the amplitude of the outward current. When associated with KCNE4, it inhibits voltage-gated potassium channel activity. The complex formed with KCNE5 only conducts current upon strong and continuous depolarization.
Protein Families
Potassium channel family, KQT (TC 1.A.1.15) subfamily, Kv7.1/KCNQ1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane. Membrane raft. Endoplasmic reticulum. Basolateral cell membrane.
Tissue Specificity
Expressed only in rectal gland and heart. Faintly expressed in intestine. Undetectable in kidney, brain, testis, liver and gills.

Q&A

What is Squalus acanthias KCNQ1 (s-KCNQ1) and how does it compare structurally to mammalian KCNQ1?

S-KCNQ1 is a potassium voltage-gated channel isolated from the salt secretory rectal gland of the spiny dogfish (Squalus acanthias). This channel was cloned using PCR-intensive techniques and demonstrates significant sequence homology with KCNQ1 from other species. Comparative analysis reveals amino acid sequence similarities of 64% with human KCNQ1, 70% with mouse KCNQ1, and 77% with Xenopus laevis KCNQ1 . The full-length protein consists of 660 amino acids, containing all key structural features typical of voltage-gated potassium channels .

When designing experiments to investigate s-KCNQ1, researchers should consider these evolutionary relationships. The greater similarity to amphibian KCNQ1 than mammalian variants suggests that s-KCNQ1 may represent an earlier evolutionary form of the channel. This makes it particularly valuable for studying fundamental mechanisms of channel function that have been conserved across vertebrate evolution.

What are the expression patterns of s-KCNQ1 in different tissues of Squalus acanthias?

Northern blot analysis using RNA from multiple tissues reveals a highly specific expression pattern for s-KCNQ1. Distinct 7.4-kb s-KCNQ1 transcripts are detected exclusively in the rectal gland and heart tissues of Squalus acanthias . This restricted expression differs from the broader pattern observed in mammals, where KCNQ1 is found across multiple epithelial tissues including kidney, lung, stomach, and cochlea, in addition to cardiac tissue.

This tissue-specificity provides important experimental considerations. For researchers isolating native s-KCNQ1, the rectal gland represents the optimal tissue source. The high expression in the salt-secreting rectal gland also indicates that s-KCNQ1 may be particularly adapted for ion transport processes in specialized secretory epithelia, making it an excellent model for studying basic epithelial transport mechanisms.

What are the key electrophysiological properties that distinguish s-KCNQ1 from mammalian KCNQ1?

Voltage-clamp analysis of recombinant s-KCNQ1 expressed in Xenopus oocytes reveals several distinctive electrophysiological properties:

  • s-KCNQ1 exhibits a notably low activation threshold of approximately -60 mV, which is significantly more negative than human KCNQ1 .

  • When co-expressed with human-IsK (h-IsK), s-KCNQ1 demonstrates faster activation kinetics and stronger rectification compared to human KCNQ1 co-expressed with h-IsK .

  • Despite these functional differences, s-KCNQ1 maintains pharmacological sensitivity to chromanol 293B comparable to mammalian KCNQ1 channels .

These properties suggest that s-KCNQ1 is evolutionarily optimized for maintaining basolateral potassium conductance in epithelial cells, particularly in the specialized environment of the elasmobranch rectal gland. When designing electrophysiological experiments, researchers should account for these differences by using appropriate voltage protocols that capture the more negative activation range of s-KCNQ1.

What are the optimal methods for recombinant expression and functional characterization of s-KCNQ1?

Successful expression and characterization of recombinant s-KCNQ1 requires careful consideration of expression systems and recording techniques:

  • Expression Systems: Xenopus oocytes have proven effective for detailed biophysical characterization of s-KCNQ1 . For mammalian expression, CHO-K1 cells provide a suitable system, achieving transfection efficiencies of approximately 80% for KCNQ1 constructs when using optimized electroporation protocols .

  • Co-expression Studies: When investigating interactions with accessory subunits, co-transfection efficiency becomes critical. Standard protocols yield approximately 70% efficiency for KCNQ1/KCNE1 co-transfections with cell viability around 89% .

  • Electrophysiological Recording: Whole-cell voltage clamp remains the gold standard for functional characterization. Key parameters to monitor include:

    • Activation threshold (approximately -60 mV for s-KCNQ1)

    • Activation kinetics (particularly when co-expressed with accessory subunits)

    • Rectification properties

    • Pharmacological responses (e.g., to chromanol 293B)

For automated patch-clamp studies, a typical experimental setup utilizes 384-well planar patch plates with multiple replicates per variant. Successful recordings generally require seal resistances ≥0.5 GΩ, which can be achieved in approximately 80% of cells with proper optimization .

How can high-throughput functional evaluation approaches be applied to KCNQ1 variant analysis?

High-throughput functional evaluation of KCNQ1 variants combines several advanced methodologies:

  • Parallel Variant Generation: Site-directed mutagenesis in multi-well format enables efficient generation of numerous variants simultaneously.

  • High-Capacity Transfection: Using electroporation platforms allows for consistent transfection across multiple variants. Optimal protocols achieve transfection efficiencies of 80.6±6.8% for KCNQ1, 74.2±8.0% for KCNE1, and 68.9±7.6% for co-transfections .

  • Automated Electrophysiology: A single 384-well planar patch plate can accommodate 5 distinct KCNQ1 variants, each seeded into 64 wells, along with wild-type controls. This approach enables:

    • Cell capture rates of 94.4±0.7%

    • Seal resistance ≥0.5 GΩ in 80.4±2.7% of cells

    • Collection of extensive replication data for robust statistical analysis

  • Standardized Analysis Pipeline: Automated analysis of key parameters (current density, activation V1⁄2, gating kinetics) ensures consistent evaluation across variants.

This integrated approach has successfully characterized 48 variants of unknown significance in KCNQ1, representing a 45% increase in functionally characterized variants . With current workflow efficiencies, approximately 12 KCNQ1 variants can be generated and evaluated within a two-week period .

What methodological approaches are most effective for analyzing dominant-negative effects of KCNQ1 variants?

Analysis of dominant-negative effects requires specialized experimental designs that mimic the heterozygous state found in many patients:

  • Co-expression Strategy: Wild-type and variant KCNQ1 are co-transfected, ideally using distinct vector backbones with different fluorescent markers to verify co-expression .

  • Expression Control: Maintaining consistent expression ratios between wild-type and variant channels is critical. Fluorescence ratio monitoring (green:red fluorescence ratio between 0.9-1.1) ensures reliable comparisons .

  • Functional Assessment: Key measurements include:

    • Relative current density compared to wild-type/wild-type controls

    • Activation V1⁄2 values

    • Normalized whole-cell current traces

  • Classification Framework: Variants can be categorized based on co-expression outcomes:

    • Dominant-negative: current levels similar to known dominant-negative controls

    • Haploinsufficient: intermediate current reduction

    • Benign: currents comparable to wild-type/wild-type expression

In one comprehensive study, 29 KCNQ1 variants that showed complete or near-complete loss-of-function as homomeric channels were evaluated for dominant-negative effects. After excluding 7 variants due to inconsistent expression levels, 17 of the remaining 22 variants exhibited dominant-negative behavior similar to the G314S control mutation .

How can s-KCNQ1 serve as a model for understanding potassium channel function in secretory epithelia?

The distinctive properties of s-KCNQ1 make it an excellent model for investigating potassium channel function in secretory epithelia:

  • Physiological Adaptation: The low activation threshold (approximately -60 mV) of s-KCNQ1 aligns with typical membrane potentials in epithelial cells, suggesting evolutionary optimization for epithelial function .

  • Specialized Expression: High expression in the salt-secretory rectal gland provides a naturally "focused" system where the primary tissue function is salt secretion, simplifying the interpretation of channel function .

  • Comparative Physiology: By examining functional differences between s-KCNQ1 and mammalian KCNQ1 channels, researchers can identify evolutionary adaptations in epithelial transport mechanisms across vertebrate lineages.

  • Modulation by Accessory Subunits: The interaction between s-KCNQ1 and h-IsK demonstrates how accessory subunits regulate channel properties. The faster activation kinetics and stronger rectification observed in s-KCNQ1/h-IsK compared to human KCNQ1/h-IsK provide insights into structure-function relationships that determine channel behavior in epithelial contexts .

Experimental approaches utilizing s-KCNQ1 should include comparative studies of basolateral membrane localization, interactions with native regulatory proteins, and responses to physiological stimuli that modulate epithelial secretion.

What insights from s-KCNQ1 can inform our understanding of pathogenic variants in human KCNQ1?

Studies of KCNQ1 variants, primarily in human channels, have revealed diverse pathogenic mechanisms:

  • Trafficking Defects: Impaired trafficking to the plasma membrane represents the most common cause of loss-of-function across all channel domains, often coinciding with protein instability .

  • Functional Impairments: Many variants, particularly in transmembrane domains, traffic normally but exhibit altered conductance, voltage dependence, or gating kinetics when expressed at the membrane .

The study of s-KCNQ1 contributes to understanding these mechanisms through:

  • Evolutionary Conservation Analysis: Comparing s-KCNQ1 and human KCNQ1 helps identify highly conserved regions that have remained unchanged over hundreds of millions of years. Variants affecting these conserved regions are more likely to be pathogenic .

  • Structure-Function Insights: The functional differences between s-KCNQ1 and human KCNQ1 highlight regions that determine species-specific properties, helping researchers understand how specific structural elements contribute to channel function .

  • "Natural Experiment" Framework: Evolutionary substitutions that differentiate s-KCNQ1 from human KCNQ1 represent naturally occurring variants that maintain function. Variants that mimic these evolutionary substitutions are generally benign, while those that differ from both human and shark sequences may disrupt critical functions .

Research has shown that dysfunctional variants are enriched in highly conserved subdomains of KCNQ1 , supporting the value of cross-species comparison in predicting variant pathogenicity.

How do computational methods for predicting KCNQ1 variant pathogenicity compare with functional studies?

Comparison of computational prediction methods with functional studies reveals important considerations for variant classification:

  • Method Performance: The KCNQ1-specific predictor Q1VarPred demonstrates superior performance compared to general pathogenicity prediction tools, achieving a Matthew's correlation coefficient of 0.581 and area under the receiver operating characteristic curve of 0.884 .

  • Mechanism-Dependent Accuracy: Prediction accuracy varies based on the specific mechanism of pathogenicity. Variants affecting highly conserved regions are generally predicted more accurately than those with subtle functional effects .

  • Clinical-Functional Concordance: Studies comparing clinical classifications with functional data have found that approximately 10-15% of variants identified in Long QT Syndrome patient cohorts exhibit normal function or only mild loss of function , highlighting potential misclassification in clinical settings.

  • Integrated Assessment: Combining computational prediction with functional data provides the most reliable classification. High-throughput functional testing has enabled validation of computational predictions for larger variant sets, with one study characterizing 48 variants of unknown significance .

These findings underscore the importance of integrating multiple lines of evidence when evaluating KCNQ1 variants, with functional studies remaining the gold standard for definitive classification.

How do the electrophysiological properties of s-KCNQ1 compare quantitatively with human KCNQ1?

The following table summarizes key electrophysiological differences between s-KCNQ1 and human KCNQ1:

Propertys-KCNQ1Human KCNQ1Functional Significance
Activation Threshold~-60 mVMore positiveEnhanced activity at resting potentials in epithelia
Activation Kinetics with IsKFasterSlowerMore rapid response to depolarization
Rectification with IsKStrongerWeakerEnhanced outward current at positive potentials
Chromanol 293B SensitivityComparableComparableConserved pharmacological response
Voltage DependenceShifted negativeMore positiveAdapted for function at epithelial resting potentials
Primary ExpressionRectal gland, heartMultiple epithelia, heartTissue-specific specialization

These differences reflect evolutionary adaptations to specific physiological roles. The negative activation threshold of s-KCNQ1 is particularly significant, as it allows the channel to contribute to basolateral potassium conductance at typical epithelial resting potentials, supporting its role in salt secretion by the rectal gland .

What approaches have proven most effective for high-throughput functional characterization of KCNQ1 variants?

High-throughput functional characterization has been successfully implemented with the following performance metrics:

ParameterPerformanceMethodological Considerations
Transfection Efficiency80.6±6.8% (KCNQ1), 68.9±7.6% (co-transfections)High-capacity electroporation optimized for cell type
Cell Viability88.8±6.7%Critical for reliable expression
Cell Capture Rate94.4±0.7%384-well planar patch plates
Seal Success Rate80.4±2.7% (≥0.5 GΩ)Ensures reliable recording quality
Processing Capacity~12 variants per 2 weeksComplete functional characterization
Replicationn≈56 per variantEnables robust statistical analysis

This methodology has enabled characterization of 48 variants of unknown significance in human KCNQ1, representing a substantial increase in functionally validated variants . The approach can be readily adapted for s-KCNQ1 studies, though species-specific optimizations may be required.

How do different mechanisms of pathogenicity in KCNQ1 variants relate to specific protein domains?

Different mechanisms of KCNQ1 dysfunction show domain-specific patterns:

DomainCommon Pathogenic MechanismsFunctional Impact
Transmembrane DomainsConductance impairment, altered voltage-dependenceNormal trafficking but dysfunctional channels at membrane
Cytoplasmic RegionsTrafficking defects, protein instabilityReduced surface expression despite synthesis
Pore RegionAltered ion selectivity, conductanceDysfunctional permeation properties
C-TerminusAssembly defects, trafficking issuesImpaired tetramerization or surface expression

Research on KCNQ1 variants has shown that:

  • Impaired trafficking is the most common cause of loss-of-function across all domains, often coinciding with protein instability

  • Many variants in transmembrane domains traffic normally but exhibit impaired conductance, altered voltage dependence, or abnormal gating when co-expressed with KCNE1

  • Domain-specific effects highlight the need for personalized treatment approaches targeting specific mechanisms of dysfunction

These patterns can inform the design and interpretation of s-KCNQ1 studies, particularly when examining the effects of site-directed mutations on channel function.

What are the critical considerations for ensuring reliable functional characterization of recombinant KCNQ1 channels?

Reliable functional characterization requires addressing several methodological challenges:

  • Expression Level Variability: Standardization is critical when comparing variants.

    • Solution: Use fluorescent tags to quantify expression; exclude data where expression levels differ significantly from wild-type (e.g., green:red fluorescence ratio <0.9 or >1.1)

    • Expected outcome: Reduced confounding from expression differences

  • Accessory Subunit Interactions: KCNQ1 properties are significantly modified by KCNE1/IsK.

    • Solution: Always test variants both alone and with relevant accessory subunits

    • Expected outcome: More physiologically relevant characterization

  • Dominant-Negative Assessment: Heterozygous effects are clinically relevant.

    • Solution: Co-express variant with wild-type at 1:1 ratio, monitored by fluorescent markers

    • Expected outcome: Better prediction of in vivo effects

  • Methodological Consistency: Recording parameters affect measured properties.

    • Solution: Standardize voltage protocols, solutions, and analysis parameters

    • Expected outcome: Reliable cross-variant comparisons

  • Statistical Power: Variability requires sufficient replication.

    • Solution: High-throughput approaches enable large sample sizes (n≈56 per variant)

    • Expected outcome: Robust detection of subtle functional differences

Addressing these considerations has enabled successful characterization of numerous KCNQ1 variants, with strong concordance between automated methods and conventional manual patch-clamp recordings .

What approaches can resolve conflicting data between computational predictions and functional studies of KCNQ1 variants?

Resolving conflicts between computational predictions and functional data requires a systematic approach:

  • Method-Specific Considerations:

    • Computational predictions vary in accuracy by prediction method and mechanism of dysfunction

    • Functional studies may be affected by experimental conditions that don't fully recapitulate physiological contexts

  • Resolution Framework:

    • Assess prediction confidence scores along with binary classifications

    • Consider domain-specific patterns of dysfunction (e.g., transmembrane vs. cytoplasmic variants)

    • Evaluate dominant-negative effects for heterozygous contexts

    • Integrate evolutionary conservation data across species, including s-KCNQ1

  • Consensus Development:

    • Combine multiple computational methods with functional data

    • Weight evidence based on known accuracy for specific variant types

    • Consider physiological context (e.g., cardiac vs. epithelial function)

Research has shown that approximately 10-15% of variants identified in Long QT Syndrome patient cohorts exhibit normal function or only mild dysfunction , highlighting the importance of functional validation even for variants with strong computational predictions of pathogenicity.

How can insights from s-KCNQ1 inform future development of treatments for KCNQ1-related disorders?

The study of s-KCNQ1 provides several valuable perspectives for developing targeted therapies:

  • Mechanism-Based Therapeutics: Understanding the diverse mechanisms of KCNQ1 dysfunction revealed through comparative studies can guide development of targeted therapies:

    • Trafficking enhancers for variants with membrane delivery defects

    • Channel activators for variants with conductance impairments

    • Allosteric modulators for variants with altered voltage sensing

  • Evolutionary Insights: The functional adaptations of s-KCNQ1 highlight structural regions that can be modified without compromising fundamental channel function, potentially identifying "safe" targets for therapeutic modulation.

  • Structure-Function Relationships: Comparing s-KCNQ1 and human KCNQ1 electrophysiological properties provides insights into how specific structural elements determine channel behavior, informing rational drug design.

  • Predictive Modeling: Incorporating s-KCNQ1 data into computational models improves prediction of variant pathogenicity, potentially enhancing early identification of at-risk individuals for preventative interventions .

Future research should focus on integrating structural biology approaches with functional studies to develop a comprehensive understanding of how sequence variations affect channel function across species, ultimately leading to personalized therapeutic strategies for KCNQ1-related disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.