Recombinant Squalus acanthias Proteolipid protein DM alpha

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during ordering for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Proteolipid protein DM alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Squalus acanthias (Spiny dogfish)
Target Protein Sequence
MGCSECCVRCLGGVPYASLIATILCFVGVALFCGCGHEALTGTEKLIELYFSNDFMDYAL LVNVIQVFQYIIYGTASFSFLYGVLLLAEGFYTTSAVKALFGEFRTTVCGRCVSATFIFL TYALGVTWMGVFAFSALPVYIYYTMWSTCQMVKYVTENGTGFDDICVDARQYGILPWNAS PGKICGLSLAAVCNTSEFELTYHLFIATFAGAAATVIALLTYMMSSTYNYAVLKFLSRDD CCTKF
Uniprot No.

Target Background

Protein Families
Myelin proteolipid protein family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in white matter in myelinating shark brain.

Q&A

What is Squalus acanthias Proteolipid protein DM alpha?

Squalus acanthias Proteolipid protein DM alpha is a transmembrane protein belonging to the lipophilin family found in the spiny dogfish shark. The full-length protein consists of 245 amino acids (P36963) and is expressed as a recombinant protein with an N-terminal His tag in E. coli expression systems . This protein is evolutionarily related to the DM-20 isoform found in other species and belongs to the highly conserved lipophilin family that can be traced back at least 550 million years . The proteolipid protein gene encodes myelin-specific protein isoforms that play crucial roles in nervous system function, as evidenced by the fact that null mutations of the PLP gene cause leukodystrophy in humans .

Why is Squalus acanthias used as a model organism in protein research?

Squalus acanthias (spiny dogfish shark) serves as an excellent vertebrate model organism because it represents one of the most primitive species exhibiting characteristics relevant to human biology. These elasmobranchs demonstrate features including:

  • Signaling molecules distributed via a closed circulatory system

  • Molecular responses for salt/water homeostasis

  • Xenobiotic transport systems similar to higher vertebrates

  • Resistance to normal hypoxic responses due to cold-water habitat adaptation

The spiny dogfish is frequently chosen due to its relative abundance, manageable size, and remarkable longevity (up to 100 years), making it valuable for evolutionary and comparative studies . Its proteins often represent ancestral forms that provide insights into fundamental biological mechanisms.

How should recombinant Squalus acanthias Proteolipid protein DM alpha be reconstituted and stored?

Proper reconstitution and storage are critical for maintaining the stability and activity of recombinant Proteolipid protein DM alpha. The recommended protocol includes:

StepProcedureRationale
1Centrifuge the vial briefly before openingEnsures all lyophilized material is at the bottom
2Reconstitute in deionized sterile water to 0.1-1.0 mg/mLProvides optimal protein concentration
3Add glycerol to 5-50% final concentrationPrevents ice crystal formation during freezing
4Aliquot for long-term storageMinimizes freeze-thaw cycles
5Store at -20°C/-80°C for long-termPrevents degradation
6Working aliquots can be kept at 4°C for up to one weekConvenient for ongoing experiments

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution . Repeated freeze-thaw cycles should be strictly avoided as they can significantly reduce protein activity.

What analytical methods are most effective for characterizing recombinant Proteolipid protein DM alpha?

Multiple complementary analytical techniques should be employed to fully characterize the recombinant protein:

  • SDS-PAGE Analysis: The primary method for purity assessment, with expected purity >90%. The recombinant His-tagged protein should appear at approximately 27-28 kDa .

  • Western Blotting: Using antibodies against either the His-tag or the protein itself to confirm identity and assess degradation.

  • Circular Dichroism (CD) Spectroscopy: Essential for evaluating proper folding of the protein's secondary structure, particularly important for transmembrane proteins.

  • Size Exclusion Chromatography (SEC): To assess oligomerization state and homogeneity in solution.

  • Mass Spectrometry: For precise molecular weight determination and verification of post-translational modifications.

  • Lipid Binding Assays: To evaluate functional interactions with membrane components.

Membrane proteins present unique analytical challenges, often requiring specialized approaches such as detergent compatibility testing and native-like membrane reconstitution for accurate structural and functional characterization.

How can site-directed mutagenesis be applied to study Proteolipid protein DM alpha function?

Site-directed mutagenesis provides a powerful approach to investigate structure-function relationships in Proteolipid protein DM alpha. The methodology should include:

  • Target Residue Identification: Select amino acids based on:

    • Sequence conservation across species

    • Predicted functional domains from homology modeling

    • Regions of interest in the transmembrane domains

  • Mutagenesis Strategy:

    • Design mutagenic primers with appropriate overlaps and melting temperatures

    • Perform PCR-based mutagenesis using systems such as QuikChange

    • Transform into competent cells and select on appropriate antibiotics

    • Verify mutations by Sanger sequencing

  • Functional Analysis:

    • Express wild-type and mutant proteins under identical conditions

    • Compare protein stability, folding, and expression levels

    • Assess functional differences through binding assays or cellular localization studies

    • Use reporter systems to quantify changes in activity

Studies of related proteins have demonstrated the effectiveness of this approach for understanding critical residues involved in protein function, as shown in the mutagenesis work on Squalus acanthias AHR1 .

How does the evolution of Proteolipid protein DM alpha inform our understanding of myelin protein function?

The evolutionary history of Proteolipid protein DM alpha provides significant insights into the fundamental and specialized functions of myelin proteins:

  • Evolutionary Timeline:

    • The lipophilin gene family originated at least 550 million years ago

    • Present in invertebrates including Drosophila and silkworms

    • The DM-20 form predates the PLP isoform, which appeared in amphibians approximately 300 million years ago

  • Structural Evolution:

    • PLP differs from DM-20 by a 35 amino acid cytoplasmic domain that emerged in amphibians

    • This domain represents a vertebrate-specific adaptation likely related to complex nervous system development

    • The core transmembrane structure remains highly conserved across species

  • Functional Implications:

    • The high conservation suggests essential roles in basic membrane organization

    • The emergence of the PLP-specific domain correlates with increased complexity in vertebrate myelin

    • Null mutations in humans cause leukodystrophy, confirming the critical nature of these proteins

This evolutionary perspective helps distinguish which protein domains are responsible for fundamental membrane functions versus specialized roles in higher vertebrate nervous systems.

What are the challenges in expressing and purifying functional Proteolipid protein DM alpha?

Expressing and purifying membrane proteins like Proteolipid protein DM alpha presents several unique challenges that require specialized approaches:

  • Expression System Selection:

    • E. coli systems often struggle with proper folding of eukaryotic membrane proteins

    • The hydrophobic nature of transmembrane domains can cause toxicity to host cells

    • Current protocols use E. coli with N-terminal His-tags, but yields may be limited

  • Solubilization Strategies:

    • Selecting appropriate detergents that maintain native structure

    • Balancing detergent concentration to prevent aggregation while maintaining membrane protein stability

    • Considering lipid supplementation to stabilize native conformations

  • Purification Complications:

    • Detergent micelles contribute to apparent molecular weight

    • Potential for non-specific aggregation during concentration steps

    • Risk of stripping essential lipids during purification

  • Functional Validation:

    • Developing assays to confirm proper folding in a membrane-like environment

    • Confirming specific interactions with known binding partners

    • Assessing oligomerization state in membrane-mimetic systems

The recombinant protein is currently available as a lyophilized powder with >90% purity as determined by SDS-PAGE, indicating successful approaches have been developed, though functional assays remain challenging .

How can homology modeling enhance our understanding of Proteolipid protein DM alpha structure?

Homology modeling provides valuable structural insights when experimental structures are unavailable, as is often the case with membrane proteins. For Proteolipid protein DM alpha, this approach would involve:

  • Template Selection and Alignment:

    • Identifying structurally characterized homologous proteins

    • Performing careful sequence alignment with special attention to transmembrane helices

    • Similar approaches have been successfully applied to other Squalus acanthias proteins

  • Model Building Process:

    • Generating multiple initial models using specialized software

    • Refining models through energy minimization and molecular dynamics simulations

    • Validating models using stereochemical criteria and energy profiles

  • Structural Analysis Applications:

    • Identifying potential binding sites and interaction interfaces

    • Predicting the effects of specific mutations

    • Providing context for interpreting experimental data

    • Guiding the design of site-directed mutagenesis experiments

A successful example of this approach is demonstrated in the homology modeling of Squalus acanthias AHR1, where models based on human HIF1α and HIF2α structural templates revealed important secondary structural characteristics and identified key residues for functional studies .

What strategies can overcome poor expression of recombinant Proteolipid protein DM alpha?

Researchers encountering difficulties with expression of Squalus acanthias Proteolipid protein DM alpha can implement several targeted strategies:

  • Expression System Optimization:

    • Test multiple E. coli strains specifically designed for membrane proteins (C41/C43)

    • Consider eukaryotic expression systems for proper post-translational modifications

    • Adjust induction conditions (temperature, inducer concentration, duration)

  • Construct Optimization:

    • Codon optimization for the expression host

    • Testing different fusion tags beyond His-tag (MBP, SUMO)

    • Creating truncated constructs that retain key domains

  • Growth Conditions:

    • Lower temperature expression (16-20°C) to improve folding

    • Supplementation with specific lipids or stabilizing agents

    • Modified media formulations to enhance membrane protein expression

  • Protein Extraction Enhancement:

    • Optimize cell lysis conditions to prevent aggregation

    • Screen multiple detergents for effective solubilization

    • Consider membrane scaffold protein co-expression

Current successful protocols achieve expression in E. coli with high purity (>90%), but yields and activity may be further optimized through systematic application of these strategies .

How can researchers distinguish between properly folded and misfolded recombinant Proteolipid protein DM alpha?

Distinguishing properly folded from misfolded membrane proteins is particularly challenging but can be approached through multiple methods:

  • Biophysical Characterization:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content

    • Tryptophan fluorescence spectroscopy to evaluate tertiary folding

    • Differential Scanning Calorimetry (DSC) to measure thermal stability

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS) to assess oligomeric state

  • Functional Assessment:

    • Binding assays with known interaction partners

    • Reconstitution into liposomes and assessment of membrane integration

    • Conformation-specific antibody recognition

  • Structure Validation:

    • Limited proteolysis to probe accessibility of cleavage sites

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Negative-stain electron microscopy to visualize protein particles

  • Comparative Analysis:

    • Side-by-side comparison with native protein when available

    • Benchmark against established quality criteria for membrane proteins

Properly folded Proteolipid protein DM alpha should demonstrate appropriate secondary structure content, stable behavior in detergent solutions, and specific interaction capabilities consistent with its native function.

What are the considerations for designing functional assays for Proteolipid protein DM alpha?

Developing meaningful functional assays for Proteolipid protein DM alpha requires careful consideration of its native environment and biological role:

  • Membrane Interaction Studies:

    • Liposome binding assays using fluorescently labeled protein

    • Reconstitution efficiency into artificial membrane systems

    • Lipid specificity profiling to identify preferential interactions

  • Protein-Protein Interaction Assays:

    • Pull-down assays with potential binding partners

    • Surface Plasmon Resonance (SPR) for quantitative binding kinetics

    • Fluorescence Resonance Energy Transfer (FRET) for proximity analysis

  • Cellular Assays:

    • Transfection into cell lines lacking endogenous expression

    • Assessment of subcellular localization using fluorescent tags

    • Rescue experiments in cells with compromised myelin formation

  • Structural Stability Measurements:

    • Thermal shift assays to assess ligand/partner binding

    • Detergent resistance as a proxy for proper folding

    • Conformational dynamics using hydrogen-deuterium exchange

  • Assay Controls and Validation:

    • Inclusion of known functional and non-functional protein variants

    • Comparison with other lipophilin family members

    • Development of quantitative readouts for statistical analysis

These approaches should be adapted based on specific research questions and available resources, with multiple orthogonal methods providing the most robust functional characterization.

How does Squalus acanthias Proteolipid protein DM alpha compare structurally to mammalian homologs?

Structural comparison between shark and mammalian proteolipid proteins reveals important evolutionary insights:

  • Sequence Comparison:

    • Shark DM alpha represents an ancestral form of the protein

    • Mammalian PLP contains an additional 35 amino acid cytoplasmic domain not present in shark DM alpha

    • Core transmembrane regions show higher conservation than extramembranous domains

  • Domain Architecture:

    • Both contain four transmembrane domains with similar topology

    • The mammalian-specific cytoplasmic domain emerged approximately 300 million years ago in amphibians

    • This domain acquisition represents a key evolutionary adaptation for complex vertebrate myelin

  • Functional Implications:

    • The high conservation in transmembrane regions suggests fundamental roles in membrane organization

    • The additional cytoplasmic domain in mammals likely confers specialized functions in compact myelin

    • Studying the shark protein provides insights into the core ancestral functions

This comparative approach helps identify which protein features were present in the common ancestor versus those that evolved specifically in the tetrapod lineage leading to mammals .

What can we learn from studying ancient proteins like Squalus acanthias Proteolipid protein DM alpha?

Studying evolutionarily ancient proteins from organisms like Squalus acanthias provides several significant research advantages:

  • Evolutionary Insights:

    • The lipophilin family originated at least 550 million years ago

    • Shark proteins often represent less specialized ancestral forms

    • Comparing ancient and modern forms helps trace the evolutionary trajectory of protein function

  • Structure-Function Relationships:

    • Identifying the minimal structural elements required for basic function

    • Understanding how additional domains contribute to specialized functions

    • Determining which features are indispensable across evolutionary time

  • Biomedical Applications:

    • The fundamental importance of these proteins is highlighted by human disease associations

    • Null mutations in the PLP gene cause leukodystrophy in humans

    • Ancient proteins may reveal core mechanisms relevant to disease pathology

  • Technical Advantages:

    • Some ancient proteins demonstrate superior stability for structural studies

    • Simplified domain architecture facilitates interpretation of functional data

    • Complementary to studies using highly evolved mammalian forms

This research perspective emphasizes the value of comparative biology in understanding fundamental protein functions that have been conserved across hundreds of millions of years of evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.