Recombinant Stage II sporulation protein E (spoIIE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spoIIE; Stage II sporulation protein E; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Bacillus megaterium
Target Names
spoIIE
Target Protein Sequence
TVGVVTGLILSFANVSSLYEMSLLAFSGLLGGLLKDGKKLGARLGLVVGSLLIGLYAQAD QGLTTNLYESLTAVVLFLLTPSFVLKNLSKLVPGTSENMLEQQQYVRKIRDVTANRVEQF SNVFQALSKSFTQNGFYDEKPSADKEVDYFLSSVTERTCQFCFKKEQCWAQQFDTTYEYM KEIMLEVDNGTLEQNPRLIREMDKHCVKSKKVIDVIEHELTYFKANQHLKAQIQESRRIV AEQLHGVSEVMGNFAKEIKRERENLNVQEEQILEALRNFGMEINQIEIYSLEPGNVDIEM WVPYCHGRGECEKIIAPMLTDILGESIVVKNEECAKYPQGYCHVSFGCTKAYVVDTGVAH AAKGGGFVSGDSYSMIELNAGKYALAISDGMGNGERAHYESSETLQLLKQILQTGIEETI AIKSINSILSLRTNDEIFSTLDLAMIDLQDANVNFLKIGSTPSFIKRGDKVIKIQASNLP MGIIEEFEVDVVNEQMKAEDLLIMMSDGVFEGPKHVENYEMWMKRKIGELQTNDPQEIAD LIMEEVIRTKVGLIEDDMTVVVAKLQHNTPKWSSIPSYAYRNLAQ
Uniprot No.

Target Background

Function
Essential for pro-sigma E processing during sporulation in most cases, although this step can be bypassed in vegetative cells. It functions by dephosphorylating and thereby activating SpoIIAA.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the main structural domains of SpoIIE and how do they relate to its function?

SpoIIE is an 872-residue polypeptide with three distinct domains, each corresponding to specific functions. The N-terminal region contains multiple membrane-spanning sequences that anchor the protein to the cell membrane. The central segment interacts with FtsZ and is involved in polar septum formation and Z-ring stabilization. The C-terminal domain possesses PP2C phosphatase activity responsible for dephosphorylating SpoIIAA-P, which leads to σF activation in the forespore. The connections between these domains are critical, as oligomerization of SpoIIE at the forespore pole links multiple functions including polar recognition, protection from proteolysis, and activation of phosphatase activity .

Why has recombinant expression of soluble SpoIIE been challenging, and what strategies have proven successful?

Expression of recombinant SpoIIE has been problematic due to unclear domain boundaries, particularly in the central FtsZ-binding region which has no similarity to domains of known structure or function. This ambiguity has hampered the expression of soluble fragments at levels required for structural studies. Successful approaches have employed random incremental truncation library techniques such as ESPRIT (Expression of Soluble Proteins by Random Incremental Truncation) to screen thousands of genetic constructs and identify stable, soluble C-terminal fragments. This methodical screening of over 9,000 constructs allowed researchers to map putative domains and determine optimal boundaries for expression . Removing the N-terminal membrane-spanning sequences while preserving specific regions of the central domain has also proven critical for obtaining soluble protein suitable for biochemical and structural studies.

What purification challenges are specific to recombinant SpoIIE and how can they be addressed?

Purification of recombinant SpoIIE presents several protein-specific challenges. First, the tendency of SpoIIE to oligomerize, while functionally important, can lead to aggregation during purification. Second, the phosphatase domain may interact with various substrates in the expression host, affecting yield and purity. Effective purification strategies include:

  • Using fusion tags (such as His6 or MBP) that can be cleaved post-purification

  • Inclusion of phosphatase inhibitors during initial extraction steps

  • Size exclusion chromatography to separate different oligomeric states

  • Careful optimization of buffer conditions to maintain stability without promoting aggregation

  • Limited proteolysis approaches to identify stable domains if full-length constructs prove unstable

Additionally, co-expression with binding partners or substrates (such as fragments of FtsZ or SpoIIAA) may enhance stability during purification processes.

How does SpoIIE facilitate compartment-specific activation of σF during sporulation?

SpoIIE employs a sophisticated three-step mechanism to ensure compartment-specific activation of σF in the forespore:

  • Capture at the cell pole: SpoIIE initially localizes to the asymmetrically positioned divisome (FtsZ ring) at the pole. Following cytokinesis, SpoIIE is transferred from the septum to the adjacent forespore pole. This sequential transfer is enforced by preferential binding to the divisome over the cell pole, and asymmetry is maintained because any SpoIIE not captured in the forespore remains sequestered at the distal divisome in the mother cell .

  • Spatially restricted proteolysis: SpoIIE is subject to degradation by the AAA+ protease FtsH but is selectively stabilized in the forespore. This proteolytic control ensures SpoIIE does not accumulate or become active prior to asymmetric division or in the mother cell following division .

  • Oligomerization: At the forespore pole, SpoIIE molecules interact to form large complexes. This oligomerization is coupled to both polar recognition and protection from FtsH degradation, as well as activation of SpoIIE's phosphatase function, which dephosphorylates SpoIIAA-P to release and activate σF .

Experimental evidence for this model comes from studies using engineered vegetative cells that undergo polar division independently of sporulation. When SpoIIE was expressed in these cells alongside FtsAZ overexpression, SpoIIE was enriched in the smaller cells and activated σF specifically in this subpopulation, confirming that polar division alone is sufficient to compartmentalize SpoIIE .

What is the relationship between SpoIIE and the asymmetric septum formation during sporulation?

SpoIIE plays dual roles in asymmetric septum formation during sporulation:

  • Divisome relocalization: SpoIIE interacts with FtsZ, the tubulin-like protein that forms the Z-ring at the site of cell division. This interaction helps to reposition the division septum from mid-cell to the cell pole during the early stages of sporulation .

  • Z-ring stabilization: Multiple Z-rings can form during sporulation, but SpoIIE specifically helps stabilize the polar Z-ring that ultimately develops into the asymmetric septum. This stabilization is critical for proper asymmetric division, though the precise molecular mechanisms remain incompletely understood .

The relationship between SpoIIE and FtsZ has been confirmed through multiple approaches, including yeast two-hybrid screens and direct biochemical assays with purified components. Importantly, this interaction couples the morphological event of polar septation to the subsequent activation of σF, ensuring that compartment-specific gene expression is properly coordinated with the physical restructuring of the cell .

Recent cryo-electron tomography studies have revealed that following asymmetric division, the septum undergoes uniform thinning (approximately 25%) as it curves into the mother cell, with peptidoglycan continuously present between the mother cell and forespore membranes. This thinning may represent a conformational change in the septal peptidoglycan from a relaxed to a stretched state, triggered by increased turgor pressure in the forespore as chromosomal DNA is translocated .

How does SpoIIE escape proteolytic degradation specifically in the forespore?

SpoIIE evades proteolytic degradation in the forespore through a mechanism linked to both its localization and oligomerization state. The key findings regarding this selective stabilization include:

  • SpoIIE is degraded by the AAA+ protease FtsH in the mother cell but protected from degradation in the forespore.

  • This protection is not due to the absence of active FtsH in the forespore, as demonstrated by experiments with model FtsH substrates that are still degraded in the forespore compartment .

  • Specific features of SpoIIE itself, rather than compartment-specific differences in proteolytic activity, are responsible for its stabilization in the forespore.

  • SpoIIE oligomerization at the forespore pole appears to be the key factor in protecting it from FtsH-mediated degradation. Experiments with the K353D variant of SpoIIE, which is defective in compartmentalization, showed that this mutation abolishes polar localization. Conversely, the suppressor mutation T353I partially restores polar localization, indicating that the same features required for polar recognition are also required for stabilization .

  • Removal of the Tag-SpoIIE degradation signal enhances polar enrichment of SpoIIE even before polar division occurs, suggesting that stabilization and polar localization are mechanistically linked .

This suggests a model wherein SpoIIE's sequestration at the forespore pole facilitates its oligomerization, which in turn renders it resistant to FtsH recognition or access, thereby creating a positive feedback loop that concentrates active SpoIIE specifically in the forespore.

What microscopy techniques are most effective for studying SpoIIE localization during sporulation?

Multiple complementary microscopy approaches provide different insights into SpoIIE localization dynamics:

  • Fluorescence microscopy with SpoIIE-GFP/mCherry fusions allows real-time tracking of protein movement during sporulation in living cells. Time-lapse imaging can capture the transfer of SpoIIE from the asymmetric septum to the forespore pole. For optimal results, fusions should be placed at positions that don't disrupt membrane topology or domain function, typically at the C-terminus or at carefully mapped interdomain regions.

  • Super-resolution techniques (STED, PALM, STORM) provide enhanced spatial resolution (20-50 nm) to better resolve SpoIIE localization patterns, particularly the oligomerization at the forespore pole that is critical for compartmentalization.

  • Cryo-electron tomography (cryo-ET) combined with cryo-focused ion beam (cryo-FIB) milling has revolutionized the visualization of sporulation structures. This approach allows reconstruction of native-state cellular sections at molecular resolution, revealing details of SpoIIE's interaction with the asymmetric septum that are not visible with other techniques .

  • Correlative light and electron microscopy (CLEM) bridges fluorescence microscopy and electron microscopy, allowing precise spatiotemporal tracking of SpoIIE in relation to cellular ultrastructure.

When studying SpoIIE localization patterns, researchers should control for potential artifacts by comparing multiple fluorescent protein fusions, validating with immunofluorescence using anti-SpoIIE antibodies, and confirming functionality through complementation assays that measure σF activation.

In vitro measurement approaches:

  • Purified component assays: Using purified recombinant SpoIIE (typically the phosphatase domain), SpoIIAA-P substrate, and appropriate buffer conditions. Phosphate release can be measured using malachite green assays, radiolabeled substrates (32P-labeled SpoIIAA-P), or phosphate-binding proteins coupled to fluorescent detection systems.

  • Kinetic parameter determination: Establishing Km, Vmax, and catalytic efficiency by varying substrate concentrations and measuring initial rates of dephosphorylation. These parameters can be compared between different SpoIIE variants to assess the impact of specific mutations.

  • Oligomerization-dependent activity: Assessing how buffer conditions, protein concentration, and presence of membranes affect SpoIIE oligomerization state and corresponding phosphatase activity.

In vivo measurement approaches:

  • Reporter gene expression: Using transcriptional fusions of σF-dependent promoters (such as spoIIQ) to fluorescent proteins or lacZ to monitor σF activation as a proxy for SpoIIE phosphatase activity.

  • Phosphorylation-specific antibodies: Developing antibodies that specifically recognize the phosphorylated or unphosphorylated states of SpoIIAA to track the phosphorylation state in different cellular compartments.

  • Genetic approaches: Creating mutations in spoIIE that affect phosphatase activity but not localization to dissect the relationship between these functions.

  • Engineered vegetative cells: Using the system described in the search results where polar division is induced in vegetative cells independently of sporulation to study the minimal requirements for compartment-specific activation of σF .

For robust phosphatase activity characterization, researchers should combine both in vitro and in vivo approaches while carefully controlling for protein stability, oligomerization state, and potential cofactors that might influence activity.

What protein-protein interaction techniques are most suitable for studying SpoIIE's interactions with FtsZ and other binding partners?

Several complementary techniques can be employed to study SpoIIE's interactions with FtsZ and other partners, each with specific advantages:

  • Yeast two-hybrid (Y2H) screening: Although mentioned in the search results as previously used to identify the SpoIIE-FtsZ interaction , Y2H has limitations for membrane-associated proteins like SpoIIE. Modified approaches such as split-ubiquitin membrane Y2H may be more appropriate for full-length SpoIIE.

  • Co-immunoprecipitation (Co-IP): Using antibodies against SpoIIE or epitope tags to pull down protein complexes from sporulating cells, followed by western blotting or mass spectrometry to identify interacting partners. This approach preserves native cellular conditions but may miss transient interactions.

  • Bacterial two-hybrid systems: These can overcome some limitations of Y2H for bacterial proteins and are performed in a prokaryotic context more similar to the native environment.

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): These techniques can measure binding kinetics (kon and koff rates) and affinities between purified SpoIIE domains and partners like FtsZ. They can also assess how oligomerization or phosphorylation states affect these interactions.

  • Förster resonance energy transfer (FRET): By tagging SpoIIE and potential binding partners with appropriate fluorophores, researchers can detect direct interactions in living cells with temporal and spatial resolution.

  • Protein fragment complementation assays: Split fluorescent proteins or enzymes fused to SpoIIE and potential partners can report on interactions through restoration of fluorescence or enzymatic activity when the proteins come together.

  • Crosslinking coupled with mass spectrometry: Chemical or photo-crosslinking followed by mass spectrometry analysis can identify interaction interfaces at amino acid resolution and capture transient interactions.

For membrane-associated proteins like SpoIIE, techniques that maintain the membrane environment (such as liposome-based assays or native membrane preparations) may provide more physiologically relevant results than those using only soluble domains.

How might targeted mutations in SpoIIE's oligomerization interfaces be designed to dissect the relationship between oligomerization, polar localization, and protease resistance?

Designing targeted mutations to dissect SpoIIE's functional relationships requires a systematic approach:

  • Identification of putative oligomerization interfaces: Based on the search results, residue K353 appears to be critical for SpoIIE compartmentalization, as the K353D mutation abolishes polar localization while the T353I suppressor partially restores it . This region likely represents part of an oligomerization interface. Additional interfaces could be identified through:

    • Homology modeling with related PP2C phosphatases

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions upon oligomerization

    • Cross-linking coupled with mass spectrometry to identify residues in close proximity in oligomers

  • Mutation strategy: Once potential interfaces are identified, researchers should design:

    • Charge reversal mutations (like K353D) that disrupt salt bridges

    • Hydrophobic to charged substitutions that disrupt core packing

    • Proline insertions that disrupt secondary structure elements

    • Conservative substitutions as controls

  • Functional assays to assess each property independently:

    • Oligomerization: Size exclusion chromatography, analytical ultracentrifugation, or FRET-based approaches

    • Polar localization: Fluorescence microscopy with wild-type and mutant SpoIIE-FP fusions

    • Protease resistance: Pulse-chase experiments or western blotting to compare protein half-lives

    • Phosphatase activity: In vitro assays with purified components

  • Creation of separation-of-function mutants: The goal would be to generate mutants that specifically affect one property while preserving others, such as:

    • Mutants that fail to oligomerize but retain phosphatase activity

    • Mutants that localize correctly but fail to be protected from proteolysis

    • Mutants that are protease-resistant but fail to localize to the pole

Such separation-of-function mutants would help establish causality between these properties and determine whether they can be uncoupled or are mechanistically interdependent.

What approaches could resolve the structural basis of SpoIIE's interaction with the cell pole and FtsZ during sporulation?

Resolving the structural basis of SpoIIE's interactions requires integrating cutting-edge structural biology with cellular approaches:

  • Cryo-electron tomography (cryo-ET) with subtomogram averaging: This technique, already applied to visualize B. subtilis sporulation , could be further focused on SpoIIE-containing structures. By imaging cells at different stages of sporulation, researchers could capture SpoIIE as it transfers from the divisome to the forespore pole.

  • In situ structural biology: Techniques like cryo-focused ion beam milling combined with electron tomography can visualize macromolecular complexes within their native cellular environment, potentially revealing SpoIIE-FtsZ structures at the asymmetric septum.

  • Single-particle cryo-EM of reconstituted complexes: Purifying SpoIIE (or stable domains identified through ESPRIT ) in complex with FtsZ filaments and/or membrane mimetics could reveal interaction interfaces at near-atomic resolution.

  • X-ray crystallography of co-crystals: Though challenging, crystallizing the SpoIIE central domain bound to FtsZ fragments could provide high-resolution structural insights into this interaction.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can map interfaces between SpoIIE and binding partners, identifying regions that become protected upon complex formation.

  • Integrative structural biology: Combining multiple structural techniques with computational modeling to build composite models of SpoIIE assemblies when high-resolution structures of complete complexes prove elusive.

  • Site-specific cross-linking coupled with mass spectrometry: By introducing photo-activatable or chemical cross-linkers at specific positions in SpoIIE and its binding partners, researchers can identify precise contact points that can constrain structural models.

These approaches would help elucidate how SpoIIE recognizes the forespore pole, how it interacts with and modulates FtsZ assembly, and how these interactions change during the progression of sporulation.

How can systems biology approaches integrate SpoIIE function within the broader regulatory network of sporulation?

Systems biology approaches offer powerful frameworks to understand SpoIIE's role within the complex regulatory network of sporulation:

These systems approaches would help position SpoIIE within the broader context of sporulation regulation and potentially identify new regulatory connections and emergent properties not evident from studying individual components.

What strategies can overcome common issues in generating stable, active recombinant SpoIIE constructs?

Researchers facing challenges with recombinant SpoIIE production can employ several targeted strategies:

  • Domain identification and construct optimization:

    • Use the random incremental truncation library approach (ESPRIT) that successfully identified soluble C-terminal fragments in previous work

    • Design constructs based on secondary structure predictions and conserved domain boundaries

    • Consider fusion proteins with solubility enhancers (MBP, SUMO, GST) with cleavable linkers

  • Expression system selection:

    • Test multiple expression systems (E. coli, B. subtilis, cell-free systems)

    • For E. coli expression, evaluate specialized strains designed for membrane proteins or toxic proteins

    • Consider codon optimization for the expression host

  • Induction and growth conditions:

    • Use lower temperatures (16-20°C) for expression to slow folding and reduce aggregation

    • Test different induction methods (IPTG concentration, auto-induction media)

    • Evaluate expression in the presence of osmolytes or chemical chaperones that might stabilize folding intermediates

  • Co-expression strategies:

    • Co-express with binding partners (FtsZ fragments, SpoIIAA) that might stabilize SpoIIE

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J) to aid proper folding

    • For membrane-spanning regions, co-express with membrane insertion machinery components

  • Protein extraction and purification:

    • Optimize lysis conditions to maintain native conformation

    • For constructs with membrane domains, evaluate detergents carefully (DDM, LMNG, amphipols)

    • Consider on-column refolding for proteins recovered from inclusion bodies

    • Implement multi-step purification with stability screens at each step

These approaches should be implemented systematically, with careful documentation of conditions and results to identify patterns that might inform successful strategies for generating stable, active recombinant SpoIIE.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.