Recombinant Stage II sporulation protein SA (spoIISA)

Shipped with Ice Packs
In Stock

Description

Introduction to spoIISA

spoIISA is a toxin protein encoded by the spoIIS locus in Bacillus subtilis, functioning as a developmental checkpoint during sporulation. It inhibits sporulation progression unless neutralized by its antidote protein, spoIISB . This toxin-antidote system ensures proper timing and regulation of asymmetric cell division, a critical step in spore formation.

Genetic Organization

  • Locus: spoIISA and spoIISB genes are co-transcribed but regulated by distinct promoters .

  • Transcription:

    • spoIISA is expressed during vegetative growth and early sporulation.

    • spoIISB is synthesized in excess due to an internal promoter, ensuring dominance over spoIISA .

Protein Structure

  • Function: SpoIISA disrupts envelope integrity post-asymmetric septation, causing lethal plasmolysis .

  • Key Domains: No structural data available, but mutations (e.g., L103F) disrupt its interaction with spoIISB .

Mechanism of Action

ProcessspoIISA ActivityspoIISB Neutralization
Sporulation InitiationBlocks progression post-asymmetric septationAllows completion of septation
Cell ViabilityInduces plasmolysis and cell deathProtects envelope integrity

Key Findings

  • SpoIISA Toxicity: In spoIISB-null mutants, sporulation efficiency drops by ~4 orders of magnitude (e.g., ~0.01% viable spores) .

  • Compartmentalization: SpoIISA acts primarily in the mother cell during stage II, while forced expression in the forespore also disrupts sporulation .

Sporulation Efficiency in Mutant Strains

StrainSporulation EfficiencyMorphological Defects
Wild Type~100%None
spoIISB mutant~0.01%Lethal plasmolysis, disrupted septa
spoIISA overexpressor<0.1%Envelope damage, cell death
spoIISA + spoIISB~5% (partial rescue)Reduced sporulation efficiency

Mutational Studies

  • spoIISA(L103F): Resistant to spoIISB neutralization, causing irreversible sporulation defects .

  • spoIISB Synthesis: Mother cell-specific expression rescues sporulation in spoIISB-null mutants .

Biotechnological Potential

  • Sporulation Control: Engineering spoIISA/spoIISB systems to modulate spore formation in industrial strains.

  • Antibiotic Targets: SpoIISA’s role in envelope integrity suggests potential for antimicrobial strategies targeting sporulating pathogens .

Challenges

  • Species Specificity: The spoIIS locus is unique to B. subtilis, limiting cross-species applicability .

  • Recombinant Production: No published data on recombinant spoIISA systems; challenges may include toxicity during expression.

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped standard with blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.

Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
spoIISA; BA_2490; GBAA_2490; Stage II sporulation protein SA; Killer protein SpoIISA; Toxin SpoIISA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
spoIISA
Target Protein Sequence
MSLVISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKG IDLTLWKNLLMFTAMVIFVDIAFILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEI YTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKIVVFEAAKELNTNFRGIR SQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLT IHHSYFSK
Uniprot No.

Target Background

Function

A toxic component of a type II toxin-antitoxin (TA) system. Expression in E. coli results in growth arrest.

Database Links

KEGG: ban:BA_2490

STRING: 260799.BAS2314

Protein Families
SpoIISA toxin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is SpoIISA and what is its role in bacterial sporulation?

    SpoIISA is part of a toxin-antitoxin system encoded by the spoIIS locus in Bacillus subtilis. SpoIISA functions as the toxin component, while SpoIISB serves as its antitoxin. This system was initially discovered during studies investigating cell differentiation in B. subtilis .

    During sporulation, the bacterial cell divides asymmetrically, forming a septum at a polar location that creates two compartments: a larger mother cell and a smaller forespore. These compartments follow distinct gene expression patterns regulated by cell-specific RNA polymerase sigma factors .

    While the exact role of SpoIISA in sporulation remains under investigation, research has shown that inactivation of spoIISB (the antitoxin) decreases sporulation efficiency by 4 orders of magnitude, whereas inactivation of spoIISA alone has no effect on sporulation. Interestingly, inactivation of spoIISA in a spoIISB null mutant background fully restores sporulation, indicating that SpoIISB is primarily required to counteract SpoIISA's negative effect on sporulation .

  • How is SpoIISA expression regulated during the bacterial life cycle?

    SpoIISA shows a complex expression pattern throughout the bacterial life cycle. Production begins during the exponential growth phase of B. subtilis, with a substantial increase occurring at the transition to stationary phase when grown in sporulation-inducing medium .

    Research indicates that SpoIISA levels peak during the first 2 hours of sporulation but diminish after the 4th hour. Notably, SpoIISA expression appears to be independent of Spo0A, the master regulator of sporulation initiation , suggesting that despite its name, SpoIISA expression is not directly controlled by the primary sporulation pathway.

    Transcriptional profiling analyses have suggested that expression of the spoIISA gene might instead be under the control of σK, which is the latest-acting of the sporulation sigma factors . This complex regulation pattern makes SpoIISA an intriguing subject for studying alternative regulatory pathways during sporulation.

  • What is the structure of SpoIISA and how does it interact with SpoIISB?

    SpoIISA is a 248 amino acid protein with a distinctive domain organization:

    • The N-terminal third contains three putative transmembrane segments that anchor the protein to the cytoplasmic membrane

    • The C-terminal two-thirds form a cytoplasmic domain (CSpoIISA)

    The crystal structure of CSpoIISA in complex with SpoIISB has been determined at 2.5 Å resolution, revealing a CSpoIISA₂·SpoIISB₂ heterotetramer. CSpoIISA has a single domain α/β structure resembling a GAF domain with an extended α-helix at its N terminus. The two CSpoIISA protomers interact extensively through an intermolecular four-helix bundle .

    SpoIISB (56 amino acids) is a natively disordered protein that adopts structure only upon binding to CSpoIISA. Each SpoIISB chain wraps around the CSpoIISA dimer, forming extensive interactions with both CSpoIISA protomers . Surface plasmon resonance experiments have shown that this complex is highly stable, with a dissociation constant in the nanomolar range .

    The structural analysis reveals that intact SpoIISA is integral to its cell killing activity, as neither the cytosolic region nor the transmembrane domain alone can exert a toxic effect .

  • What cellular processes are affected by SpoIISA inactivation?

    Inactivation of SpoIISA has profound effects beyond just sporulation. Transcriptomic studies in Clostridium beijerinckii have revealed that approximately 5% of genes are differentially expressed in a spoIISA mutant compared to the wild type strain, with only 12% of these being known sporulation genes .

    The following cellular processes are significantly affected by SpoIISA inactivation:

    ProcessEffect in ΔspoIISA mutantReference
    SporulationCompletely abolished
    Cell morphologyElongated cells with multiple septa
    Solvent productionAltered (increased in some conditions)
    Stress responseGenes differentially expressed
    Cell wall formationGenes down-regulated
    MotilityGenes up-regulated (late stage)
    Carbohydrate metabolismDifferential expression
    Amino acid/ion transportGenes down-regulated

    These results indicate an intricate interdependence between sporulation and stationary phase cellular events that is mediated in part by SpoIISA .

Advanced Research Questions

  • How does localization of SpoIISA in the cell membrane contribute to its function?

    SpoIISA's membrane localization is critical to its function as a toxin:

    Membrane Localization Mechanism:

    SpoIISA contains three predicted transmembrane segments in its N-terminal region that anchor it to the cytoplasmic membrane . This localization is essential for its toxic activity, as evidenced by observations that:

    • Intact SpoIISA is required for toxicity; neither the cytosolic domain nor the transmembrane domain alone is sufficient

    • Cells expressing SpoIISA in the absence of SpoIISB exhibit membrane damage, including plasmolysis zones and holes in the peptidoglycan layer

    Visualization Techniques:

    To study SpoIISA localization, researchers have employed:

    1. Membrane fractionation followed by western blotting with anti-SpoIISA antibodies

    2. Fluorescence microscopy with SpoIISA-GFP fusion proteins

    3. Immunofluorescence microscopy using specific antibodies

    These approaches have revealed that SpoIISA not only localizes to the cytoplasmic membrane but can also form higher-level structures in a cell-wall-dependent manner .

    Functional Implications:

    SpoIISA's membrane localization suggests it may function similar to holins (membrane proteins that create holes during bacteriophage infection) . This hypothesis is supported by observations that:

    • SpoIISA expression causes membrane disruption in both B. subtilis and E. coli

    • SpoIISA localization changes during different growth phases

    • The toxic effect requires membrane integration

    Understanding this localization is crucial for developing recombinant approaches to study or utilize SpoIISA.

  • How do different research models compare for studying SpoIISA function across bacterial species?

    Comparative analysis of SpoIISA across different bacterial species reveals important insights:

    SpeciesSpoIISA FunctionRegulationMutant PhenotypeExperimental Advantages
    B. subtilisToxin in TA systemIndependent of Spo0A, possibly σK-controlledNo effect alone; restores sporulation in spoIISB null mutantWell-characterized genetic system; extensive molecular tools
    C. beijerinckiiRequired for sporulation completionUnknownAsporogenous but produces granulose and solvents; elongated cells with multiple septaIndustrial relevance; solvent production analysis
    C. acetobutylicumFunctions in early sporulationUnknownAsporogenous but produces solventsModel solventogenic organism

    Choosing the Appropriate Model:

    When selecting a model system for SpoIISA research, consider:

    1. Research question specificity - for basic mechanistic studies, B. subtilis offers the most developed genetic toolkit

    2. Metabolic context - for studies linking sporulation to solvent production, Clostridium species are more appropriate

    3. Evolutionary perspectives - comparative studies across multiple species can reveal conserved functions

    Cross-species Validation:

    To establish conserved functions:

    • Perform complementation experiments across species

    • Construct chimeric proteins combining domains from different species

    • Compare phenotypes of equivalent mutations across species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.