Recombinant Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase (crtQ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus 4,4'-Diaponeurosporenoate Glycosyltransferase (crtQ)

The recombinant enzyme 4,4'-diaponeurosporenoate glycosyltransferase (crtQ) is a glycosyltransferase (GT) encoded by the crtQ gene in Staphylococcus aureus. It plays a critical role in the biosynthesis of staphyloxanthin, a C30 carotenoid pigment responsible for the golden coloration of S. aureus and its resistance to oxidative stress and host immune responses . Recombinant crtQ refers to the heterologously expressed version of this enzyme, often used in biochemical studies to dissect its catalytic mechanism and functional roles.

Biochemical Function and Catalytic Mechanism

crtQ belongs to the glycosyltransferase family A (GT-A) and catalyzes the esterification of glucose at the C1'' position of 4,4'-diaponeurosporenic acid, forming glycosyl-4,4'-diaponeurosporenoate . This reaction is a pivotal step in staphyloxanthin biosynthesis, bridging the oxidative modification of carotenoid intermediates and their subsequent acylation.

Key Reaction:

4,4’-diaponeurosporenic acid + GlucosecrtQGlycosyl-4,4’-diaponeurosporenoate\text{4,4'-diaponeurosporenic acid + Glucose} \xrightarrow{\text{crtQ}} \text{Glycosyl-4,4'-diaponeurosporenoate}
ParameterValue/Description
EC Number2.4.1.- (Hexosyltransferases)
Substrates4,4'-diaponeurosporenic acid, Glucose
ProductGlycosyl-4,4'-diaponeurosporenoate
GenecrtQ (Encoded in crtOPQMN operon)

Source:

Role in Staphyloxanthin Biosynthesis

Staphyloxanthin biosynthesis involves a six-enzyme pathway:

StepEnzymeFunction
1CrtMSynthesizes dehydrosqualene from farnesyl diphosphate .
2CrtNDesaturates dehydrosqualene to 4,4'-diaponeurosporene .
3CrtPOxidizes 4,4'-diaponeurosporene to 4,4'-diaponeurosporenic acid .
4crtQGlycosylates 4,4'-diaponeurosporenic acid .
5CrtOAcylates the glycosylated intermediate with 12-methyltetradecanoic acid .

Source:

Functional Studies in E. coli

  • Pathway Reconstitution: Heterologous expression of crtOPQMN in E. coli yields glycosyl-4,4'-diaponeurosporenoate as a major product, confirming crtQ’s role .

  • Intermediate Accumulation: Deletion of crtQ leads to accumulation of 4,4'-diaponeurosporen-4-al, highlighting its necessity for downstream acylation .

Drug Target Potential

  • Inhibitor Screening: CrtM (early pathway enzyme) is targeted by cholesterol biosynthesis inhibitors, underscoring the pathway’s vulnerability .

  • Vaccine Development: Staphyloxanthin’s role in virulence makes crtQ a candidate for anti-infective therapies .

Table 1: Enzyme Characteristics

PropertyDetail
UniProt IDQ2FV58
Gene LocusSAOUHSC_02880
TaxonomyStaphylococcus aureus subsp. aureus
Catalytic ActivityGlucose esterification at C1'' position

Source:

Table 2: Staphyloxanthin Biosynthetic Pathway

EnzymeSubstrateProduct
CrtMFarnesyl diphosphateDehydrosqualene
CrtNDehydrosqualene4,4'-Diaponeurosporene
CrtP4,4'-Diaponeurosporene4,4'-Diaponeurosporenic acid
crtQ4,4'-Diaponeurosporenic acidGlycosyl-4,4'-diaponeurosporenoate
CrtOGlycosyl-4,4'-diaponeurosporenoateStaphyloxanthin

Source:

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. If you have any preferences for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point for your preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you have specific tag type preferences, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
crtQ; SAOUHSC_02880; 4,4'-diaponeurosporenoate glycosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
crtQ
Target Protein Sequence
MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLK YRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ
Uniprot No.

Target Background

Function
This enzyme catalyzes the glycosylation of 4,4'-diaponeurosporenoate. Specifically, it esterifies glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, forming glycosyl-4,4'-diaponeurosporenoate. This reaction is a crucial step in the biosynthesis of staphyloxanthin, an orange pigment found in most staphylococci strains.
Database Links
Protein Families
Glycosyltransferase 2 family, CrtQ subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.