Recombinant Staphylococcus aureus Accessory gene regulator protein B (agrB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Staphylococcus aureus Accessory Gene Regulator Protein B (AgrB) is a genetically engineered transmembrane protein critical to the agr quorum-sensing (QS) system. This system regulates virulence factor production in S. aureus, making AgrB a key target for therapeutic and mechanistic studies. Recombinant AgrB is typically expressed in Escherichia coli with a His-tag for purification and functional analysis .

Protein Architecture

AgrB is a membrane-embedded peptidase with a six-helical transmembrane domain (6TMD) topology . Key structural features include:

  • Transmembrane helices: Critical for membrane localization and interaction with AgrD .

  • Extracellular Loop 1 (ECL1): Determines group-specific processing of AgrD in agr group I .

  • Hydrophilic segments: Essential for group II AgrB activity .

Role in Quorum Sensing

AgrB processes the AgrD pro-peptide into the autoinducing peptide (AIP), a cyclic thiolactone that activates the agr system . Key findings include:

  • AgrB-AgrD interaction: AgrB binds AgrD via its C-terminal domain, facilitating thiolactone ring formation .

  • Reversibility: AgrB-mediated cyclization is reversible in vivo, influencing AIP yield .

  • Group specificity: Chimeric AgrB studies revealed that:

    • Group I specificity depends on the first transmembrane helix and ECL1 .

    • Group II specificity relies on hydrophilic segments .

Mechanistic Studies

  • Split luciferase assays: Demonstrated AgrB self-interaction and AgrB-AgrD binding in vivo .

  • Molecular dynamics (MD) simulations: Revealed conformational changes in AgrB upon AgrD binding .

Therapeutic Targeting

AgrB is a candidate for quorum-quenching therapies due to its role in virulence regulation . Strategies include:

  • Inhibitors: Blocking AgrB-AgrD interaction to suppress AIP production .

  • Cross-group inhibition: Using non-cognate AIPs to disrupt QS .

Challenges and Future Directions

  • Structural resolution: Full-length AgrB structure remains unsolved due to membrane localization challenges .

  • Therapeutic optimization: Improving inhibitor specificity to avoid off-target effects .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please communicate with us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
agrB; SAUSA300_1989; Accessory gene regulator protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Staphylococcus aureus (strain USA300)
Target Names
agrB
Target Protein Sequence
MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP IFFIKEDLK
Uniprot No.

Target Background

Function
Essential for the production of the autoinducing peptide (AIP), a signal molecule in a quorum sensing system. This quorum sensing system regulates the expression of virulence factor genes. AgrB is involved in the proteolytic processing of AgrD, the precursor of AIP.
Database Links
Protein Families
AgrB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Staphylococcus aureus accessory gene regulator (agr) system?

The accessory gene regulator (agr) system in S. aureus is a conserved quorum sensing mechanism found in diverse Gram-positive bacteria. It functions as a cell density-dependent gene regulation system that controls virulence factor expression. The system consists of several components including AgrA, AgrB, AgrC, and AgrD, which work together to produce and respond to autoinducing peptides (AIPs). The agr system enables bacterial populations to coordinate their behavior based on cell density, allowing for synchronized expression of virulence factors when sufficient population density is reached .

What is the structural topology of AgrB protein?

AgrB is a membrane-integrated peptidase with a six helical transmembrane domain (6TMD) topology. Homology modeling and molecular dynamics annealing have been used to characterize its conformations in model membranes. The protein has both cytoplasmic and extracellular domains connected by transmembrane segments. This structure is critical for its function as it positions the catalytic residues appropriately for interacting with and processing the AgrD peptide .

How does AgrB interact with AgrD in the quorum sensing pathway?

AgrB interacts directly with AgrD to form a stable AgrBD complex. In this interaction, AgrD, which behaves as a disordered peptide, binds N-terminally to membranes in both the absence and presence of AgrB. In silico membrane complexes of AgrD and dimeric AgrB show non-equivalent AgrB monomers responsible for initial binding and for processing, respectively. Split luciferase assays in S. aureus have provided experimental evidence of this direct interaction. The formation of the AgrBD complex is essential for the processing of AgrD to generate the autoinducing peptide (AIP), which serves as the quorum sensing signal molecule .

What experimental evidence confirms AgrB-AgrB self-interaction?

Split luciferase assays in S. aureus have demonstrated that AgrB interacts with itself, likely forming dimers or multimers. In these experiments, AgrB proteins were tagged with either N-terminal or C-terminal luciferase fragments (SmBiT or LgBiT). High light output, indicating strong AgrB-AgrB interactions, was observed only when both N- and C-terminally tagged AgrBs were present. This finding suggests that AgrB forms specific dimeric complexes with defined orientation, which may be essential for its function in processing AgrD .

How can molecular dynamics simulations enhance our understanding of AgrB conformational changes?

Molecular dynamics simulations provide valuable insights into AgrB's conformational dynamics in membrane environments. For effective simulations:

  • Select appropriate membrane models (e.g., POPC or mixed lipid bilayers) that mimic bacterial membranes

  • Perform energy minimization followed by equilibration phases (NVT and NPT ensembles)

  • Run production simulations for sufficient time (300+ ns) to observe conformational stability

  • Analyze trajectories for RMSD, RMSF, and secondary structure content

  • Identify potential binding pockets and conformational changes upon ligand interaction

The search results indicate that successful AgrB simulations have been performed using NAMD with a time step of 2 fs, non-bonded cut-off of 12 Å, and particle-mesh Ewald method for long-range electrostatics. Simulations reaching steady RMSD values (approximately 2.56 Å) after 30 ns suggest structural stability .

What biophysical techniques are most effective for characterizing AgrB-AgrD interactions?

Multiple complementary biophysical approaches have proven effective for studying AgrB-AgrD interactions:

Research has shown that these techniques can effectively demonstrate that AgrB and AgrD form stable complexes, with AgrB exhibiting enhanced thermal stability in the presence of AgrD. SRCD and Landau analysis have proven particularly useful in monitoring conformational changes that occur upon complex formation .

What is the mechanism of AgrD processing by AgrB to generate AIP?

The mechanism of AgrD processing involves several coordinated steps:

  • Initial binding of AgrD N-terminus to the membrane

  • Interaction of AgrD with dimeric AgrB, where one monomer is responsible for binding and the other for processing

  • Endopeptidase activity of AgrB cleaves AgrD's C-terminal region

  • Thioesterase activity forms a thioester bond, creating the characteristic thiolactone ring structure of AIP

  • Export of the processed AIP to the extracellular environment

The search results indicate that AgrB's catalytic activity can be reconstituted in vitro using either E. coli membranes containing recombinant AgrB or purified AgrB protein supplemented with phospholipids (e.g., DOPG). The processing can be detected by Western blotting using antibodies against either AgrB or tagged versions of AgrD .

How do different Staphylococcal species vary in their AgrB structure and function?

While the search results don't provide specific information on species variation, this question would typically address:

  • Sequence homology analysis across different Staphylococcal species

  • Comparison of transmembrane topology predictions

  • Differences in catalytic residues that may affect processing efficiency

  • Species-specific AIP structures and their relationship to AgrB processing

  • Cross-species compatibility (or incompatibility) of AgrB-AgrD pairs

Understanding these differences is crucial for developing targeted anti-virulence strategies that might disrupt quorum sensing in pathogenic species while minimizing effects on commensal bacteria.

How can split luciferase assays be optimized for studying AgrB interactions in vivo?

Split luciferase assays provide a powerful approach for monitoring protein interactions in living cells. For optimal results when studying AgrB:

  • Strategic tag placement: Tag AgrB at both N- and C-termini with complementary luciferase fragments (SmBiT and LgBiT). Data shows that orientation matters significantly for detecting interactions.

  • Expression system selection: Use both chromosomal integration and plasmid-based expression. The research used ectopic chromosomal integration at the attB2 site for one partner and plasmid expression for the other.

  • Controls implementation: Include control strains expressing only individual luciferase fragments (SmBiT or LgBiT) to account for background signal.

  • Substrate delivery: Use furimazine as the luciferase substrate for optimal sensitivity and low background.

  • Signal quantification: Measure bioluminescence in relative light units (RLU) with multiple technical replicates (at least three) and biological triplicates.

Results demonstrate that this approach can effectively detect both AgrB-AgrB and AgrB-AgrD interactions, with specific orientations showing significantly higher signals. For AgrB-AgrD interactions, C-terminally tagged proteins (AgrB-SmBiT and AgrD-LgBit) showed the strongest interaction signal .

What in vitro systems can be established to measure AgrB activity?

Effective in vitro assay systems for AgrB include:

  • Membrane preparation approach:

    • Express AgrB in E. coli C41(DE3) cells using vectors like pCDFDuet

    • Prepare bacterial membranes containing AgrB

    • Incubate membranes with purified T7-tagged AgrD

    • Detect processing via Western blotting using antibodies against AgrD tag

  • Reconstituted system with purified components:

    • Purify recombinant AgrB protein

    • Supplement with phospholipids (e.g., DOPG at 1 mg/mL)

    • Add buffer containing T7-AgrD and incubate at 37°C

    • Analyze processing products by gel electrophoresis and Western blotting

  • AIP detection using bioreporter strains:

    • Use S. aureus bioreporter strains like ROJ143 that emit bioluminescence in response to AIP

    • Quantify AIP production via bioluminescence output

    • This approach confirms the biological activity of the processed AIP

What expression systems are most effective for producing recombinant AgrB?

Based on the available information and standard practices for membrane proteins:

  • Bacterial expression:

    • E. coli C41(DE3) strain has been successfully used for AgrB expression

    • Vectors like pCDFDuet provide controlled expression

    • Growth at lower temperatures (16-25°C) may improve proper membrane insertion

    • Induction with lower IPTG concentrations (0.1-0.5 mM) can help prevent inclusion bodies

  • Optimization considerations:

    • Codon optimization for the expression host

    • Addition of fusion tags that can aid in expression and purification

    • Use of specialized media and induction conditions

    • Selection of appropriate detergents for membrane protein extraction

The search results confirm that functional AgrB can be produced in E. coli expression systems, as demonstrated by its ability to process AgrD peptide in membrane preparations from transformed E. coli .

How can thermal stability analysis be used to study AgrB-AgrD complex formation?

Thermal stability analysis provides valuable insights into protein-protein interactions and complex formation:

  • Experimental approach:

    • Use Synchrotron Radiation CD (SRCD) to monitor secondary structure as a function of temperature

    • Define a normalized thermodynamic order parameter (s) related to helical protein content

    • Express the free energy in a Landau series expansion

    • Minimize G(s) to determine system stability conditions

    • Calculate melting temperature (Tm) and compare stability with and without binding partners

  • Data interpretation:

    • Enhanced thermal stability (higher Tm) indicates complex formation

    • The normalized temperature separation between melting and spinodal temperatures provides information about the nature of the transition

    • Linear fitting of temperature dependence allows determination of the equation of state for the protein system

This approach has successfully demonstrated that AgrB exhibits enhanced thermal stability in the presence of AgrD, providing thermodynamic evidence for complex formation .

What are the main difficulties in obtaining structural information about AgrB?

Membrane proteins like AgrB present several challenges for structural characterization:

  • Expression and purification challenges:

    • Maintaining proper folding in detergent micelles

    • Preventing aggregation during purification

    • Obtaining sufficient quantities for structural studies

  • Crystallization barriers:

    • Difficulty in forming well-ordered crystals due to flexible regions

    • Detergent micelles complicate crystal packing

    • Multiple conformational states may prevent homogeneous samples

  • Alternative approaches:

    • Homology modeling combined with molecular dynamics provides preliminary structural insights

    • SRCD and SAXS can provide lower-resolution structural information

    • Cryo-EM is emerging as a promising technique for membrane protein structures

The current research has utilized homology modeling and molecular dynamics to predict AgrB structure in the absence of high-resolution experimental structures .

How can we validate computational models of AgrB structure?

Computational models require experimental validation through multiple approaches:

The research indicates that computational predictions of AgrB's six transmembrane domain topology have been experimentally confirmed through functional studies .

How might targeting AgrB-AgrD interactions lead to novel anti-virulence strategies?

Disrupting AgrB-AgrD interactions represents a promising anti-virulence approach:

  • Rationale: Inhibiting AgrB would block AIP production, preventing quorum sensing activation and reducing virulence factor expression without directly killing bacteria (potentially reducing selective pressure for resistance)

  • Potential approaches:

    • Design of peptide mimetics that compete with AgrD for binding to AgrB

    • Small molecule inhibitors targeting the AgrB active site

    • Compounds that stabilize inactive AgrB conformations

    • Antibodies or nanobodies targeting accessible extracellular loops of AgrB

  • Advantages over traditional antibiotics:

    • Reduced selection pressure for resistance

    • Potential for pathogen-specific targeting

    • Preservation of beneficial microbiota

    • Possible combination with traditional antibiotics for enhanced efficacy

Research on AgrB structure and interactions provides the foundation for rational design of such inhibitors .

What implications does AgrB research have for understanding bacterial communication networks?

Understanding AgrB contributes to broader knowledge of bacterial communication:

  • Cross-species signaling: Research on AgrB processing specificity helps explain how different Staphylococcal species maintain distinct communication channels

  • Multimodal sensing integration: The agr system represents one component of complex bacterial sensing networks that integrate multiple environmental signals

  • Evolutionary insights: Structural and functional conservation of AgrB across species provides clues about the evolution of quorum sensing systems

  • Microbiome interactions: Understanding species-specific quorum sensing may help explain competitive and cooperative interactions within polymicrobial communities

  • Biofilm development: AgrB's role in quorum sensing directly impacts biofilm formation, a major factor in persistent infections

These broader implications highlight why fundamental research on proteins like AgrB has significance beyond the immediate mechanistic understanding .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.