Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA)

Shipped with Ice Packs
In Stock

Description

Antiholin-like Activity

LrgA inhibits murein hydrolase activity by counteracting holin-like proteins (e.g., CidA). This antagonistic interaction regulates cell lysis and death :

  • Penicillin tolerance: lrgAB mutants exhibit increased sensitivity to penicillin due to unchecked murein hydrolase activity .

  • Biofilm modulation: Controls extracellular DNA release by regulating cell lysis during biofilm maturation .

Metabolic Transport

Recent studies reveal LrgA’s role in pyruvate uptake under microaerobic conditions, linking cell death regulation to metabolic by-product transport .

Genetic and Phenotypic Analysis

StudyKey FindingsReference
cidA/lrgA oligomerizationCysteine residues in LrgA are critical for oligomerization; mutations increase biofilm adhesion and cell lysis .
lrgAB deletionEnhanced extracellular murein hydrolase activity and penicillin-induced killing .
Holin-antiholin interactionLrgA suppresses CidA-mediated lysis in a bacteriophage-like regulatory system .

Functional Validation

  • Lysis cassette assays: Co-expression of LrgA with endolysins (e.g., PlyB) confirmed its antiholin-like pore-forming activity .

  • Membrane vesicle leakage: Recombinant LrgA induces small-molecule leakage, confirming its membrane-disrupting potential .

Applications in Research

  • Biofilm studies: Used to investigate extracellular DNA release and biofilm structural integrity .

  • Antibiotic tolerance models: Critical for understanding mechanisms of penicillin resistance in S. aureus .

  • Metabolic engineering: Explored for roles in pyruvate transport and anaerobic growth .

Future Directions

  • Structural resolution: Cryo-EM studies to map LrgA’s pore-forming domains.

  • Therapeutic targeting: Exploiting LrgA-CidA interactions to disrupt biofilms or enhance antibiotic efficacy.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please specify your preference in order remarks, and we will fulfill your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us beforehand, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lrgA; SAV0262; Antiholin-like protein LrgA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
lrgA
Target Protein Sequence
MKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVKLG EVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQII MKVTSRSKGDKVTKKIKIEEAQAHD
Uniprot No.

Target Background

Function
This protein inhibits the expression or activity of extracellular murein hydrolases by interacting, possibly with LrgB, with the holin-like proteins CidA and/or CidB. The LrgAB and CidAB proteins potentially affect the proton motive force of the membrane. It may be involved in programmed cell death (PCD), possibly triggering PCD in response to antibiotics and environmental stresses.
Database Links

KEGG: sav:SAV0262

STRING: 158878.SAV0262

Protein Families
CidA/LrgA family, LrgA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is LrgA and what is its primary function in Staphylococcus aureus?

LrgA is a membrane-associated protein encoded by the lrgAB operon in Staphylococcus aureus. It functions primarily as an antiholin-like protein with an inhibitory effect on murein hydrolase activity. LrgA works in opposition to CidA (a holin-like protein) to regulate cell death and lysis during biofilm development . Recent research has revealed that LrgA also plays a significant role in overflow metabolism, particularly in the transport of pyruvate during microaerobic growth conditions .

To study LrgA's primary function, researchers typically employ gene knockout methodologies to create ΔlrgA mutants, followed by phenotypic characterization through:

  • Biofilm formation assays using crystal violet staining

  • Quantification of extracellular DNA (eDNA) release

  • β-galactosidase release assays to measure cell lysis

  • Fluorescence microscopy with live/dead staining to assess cell death patterns within biofilms

Comparing wild-type and mutant strains under various growth conditions allows researchers to differentiate between LrgA's roles in programmed cell death versus metabolic functions .

How is LrgA structurally characterized and how does it localize within bacterial cells?

LrgA is a relatively small protein containing multiple transmembrane domains with charge-rich N and C termini, similar to bacteriophage antiholins . Its structural characterization typically involves:

Membrane Fractionation Protocol:

  • Culture S. aureus cells to appropriate growth phase

  • Harvest cells by centrifugation (e.g., 5,000 × g for 10 min)

  • Resuspend in buffer containing protease inhibitors

  • Disrupt cells using mechanical methods (sonication or French press)

  • Remove cell debris by low-speed centrifugation

  • Ultracentrifuge the supernatant (e.g., 100,000 × g for 1 h)

  • Analyze the membrane fraction for LrgA using Western blotting

For cellular localization, fluorescent protein fusion constructs have proven effective. Research has employed superfolder green fluorescent protein (sGFP) fusions using the "splicing by overlap extension" (SOE) technique . This involves:

  • PCR amplification of lrgA with appropriate primers incorporating restriction sites

  • Creation of translational fusions with sGFP

  • Expression of these constructs in S. aureus

  • Visualization using fluorescence microscopy

These techniques have confirmed that LrgA localizes to the bacterial membrane, consistent with its proposed function as an antiholin .

What is the relationship between LrgA and CidA proteins in S. aureus?

The relationship between LrgA and CidA represents a bacterial control system analogous to the holin/antiholin systems in bacteriophages. Their functional relationship includes:

CharacteristicCidALrgA
FunctionHolin-like proteinAntiholin-like protein
Effect on murein hydrolasePositive (promotes activity)Negative (inhibits activity)
Effect on cell lysisPromotes lysisInhibits lysis
Role in biofilm formationPromotes eDNA releaseRegulates excessive lysis
Pore formation efficiencyHigher (more efficient)Lower
OligomerizationForms high-molecular-mass complexes via disulfide bondsForms high-molecular-mass complexes via disulfide bonds

Both proteins are membrane-associated and form oligomeric structures dependent on disulfide bonds. CidA mutants exhibit decreased lysis during biofilm formation, while lrgAB mutants show increased lysis . Experimental approaches to study their relationship typically include:

  • Genetic complementation studies

  • Double knockout mutants (ΔcidAΔlrgA)

  • Protein-protein interaction analyses

  • Comparative phenotypic characterization of single and double mutants

  • Transcriptional analysis of compensatory expression patterns

Recent vesicle studies have demonstrated that while both proteins can form membrane pores, CidA functions at a lower protein/lipid ratio than LrgA, indicating that CidA is the more efficient holin of the two .

How does disulfide bond-dependent oligomerization affect LrgA function?

Disulfide bond formation plays a critical role in LrgA oligomerization and function. Research has demonstrated that LrgA forms high-molecular-mass complexes through disulfide bonds between cysteine residues . To investigate this phenomenon, researchers employ site-directed mutagenesis to convert the cysteine residues of LrgA to serines.

Experimental Methodology:

  • Generate mutagenic PCR fragments using primers containing the desired mutations

  • Construct expression vectors with mutated LrgA (Cys→Ser)

  • Express wild-type and mutant proteins in S. aureus

  • Analyze oligomerization patterns using non-reducing SDS-PAGE

  • Perform functional assays to assess the impact on LrgA activity

Similar to bacteriophage holins, where cysteine-mediated dimerization has a negative effect on the timing of host cell lysis, cysteine mutations in LrgA would be expected to affect its function in controlling cell death and lysis .

The results typically show that disruption of disulfide bond formation affects LrgA's ability to regulate cell lysis, potentially altering the balance of the CidA/LrgA system. This has implications for biofilm development and antibiotic tolerance, making the understanding of oligomerization mechanisms particularly important for therapeutic approaches targeting S. aureus biofilms .

What are the methodological approaches for studying LrgA's role in pyruvate transport?

Recent research has identified LrgA's role in pyruvate utilization, particularly under microaerobic conditions . To investigate this metabolic function, researchers employ a combination of:

Biochemical Approaches:

  • Radiolabeled pyruvate uptake assays: Measure the transport of 14C-labeled pyruvate in wild-type versus ΔlrgA strains

  • Metabolite profiling: Quantify intracellular and extracellular pyruvate levels using high-performance liquid chromatography (HPLC) or mass spectrometry

  • Liposome reconstitution experiments: Incorporate purified LrgA into synthetic vesicles to directly assess pyruvate transport capabilities

Genetic and Molecular Approaches:

  • Growth phenotype analysis of ΔlrgA mutants in media with pyruvate as the sole carbon source

  • Transcriptional profiling to identify changes in metabolic gene expression

  • Reporter gene fusions to monitor lrgAB expression under various metabolic conditions

Physiological Studies:

  • Oxygen consumption rate measurements

  • Membrane potential analysis using fluorescent dyes

  • Intracellular pH monitoring during pyruvate metabolism

A critical aspect of these studies is controlling the oxygen availability, as lrgAB expression has been shown to be induced under microaerobic conditions . Researchers typically use controlled bioreactors or anaerobic chambers with defined oxygen concentrations to simulate the microenvironments where pyruvate transport would be physiologically relevant.

How can researchers differentiate between LrgA's role in programmed cell death versus metabolic functions?

Distinguishing between LrgA's dual functions presents a significant experimental challenge. Effective research approaches include:

Temporal Segregation Studies:

  • Time-course experiments monitoring both cell death markers and metabolite profiles

  • Inducible expression systems to control LrgA levels at different growth phases

  • Single-cell analysis to correlate metabolic activity with cell death events

Mutational Analysis:

  • Generate domain-specific mutations targeting regions hypothesized to be involved in either function

  • Create chimeric proteins combining domains from related transporters with LrgA

  • Screen for suppressor mutations that restore one function but not the other

Environmental Manipulation:

  • Vary carbon sources and oxygen availability to shift metabolic demands

  • Compare biofilm versus planktonic growth conditions

  • Introduce metabolic inhibitors to block specific pathways

ParameterPCD Function AssessmentMetabolic Function Assessment
Growth phaseStationary phase focusExponential/microaerobic focus
Key measurementsCell lysis, eDNA release, membrane integrityPyruvate uptake, metabolite profiles, oxygen consumption
Genetic contextExamine with cidA mutationsExamine with pyruvate metabolism gene mutations
Environmental triggersAntibiotic stress, nutrient limitationCarbon source shifts, oxygen limitation

A critical experimental design would include conditions that theoretically separate these functions, such as creating a metabolic environment where pyruvate transport is essential but cell death is undesirable, or vice versa. The resulting data should be analyzed using multivariate statistical methods to deconvolute the overlapping phenotypes .

What experimental models best demonstrate LrgA's impact on biofilm formation?

Biofilm models are essential for understanding LrgA's physiological role. The most effective experimental systems include:

Static Biofilm Assays:

  • Microtiter plate-based crystal violet staining for quantitative biomass assessment

  • Confocal laser scanning microscopy (CLSM) with live/dead staining to visualize spatial distribution of cell death

  • eDNA quantification using fluorescent DNA-binding dyes

Flow Cell Systems:

  • Continuous culture under defined shear stress

  • Real-time imaging of biofilm development

  • Controlled nutrient and oxygen gradients

In Vivo-Relevant Models:

  • Implant-associated biofilm models using relevant materials

  • Host-mimicking conditions (temperature, pH, presence of host factors)

  • Polymicrobial biofilm systems

Research has shown that S. aureus mutants with altered LrgA function display changed biofilm properties. For example, a cidA cysteine mutant exhibited increased biofilm adhesion in static assays and greater dead-cell accumulation during biofilm maturation . This suggests that the oligomerization state of these proteins affects their function in regulating cell death and lysis during biofilm development.

To comprehensively analyze LrgA's role, researchers should employ multiple complementary biofilm models and quantify multiple parameters including:

  • Biofilm biomass

  • Spatial architecture

  • Mechanical properties

  • Matrix composition (particularly eDNA content)

  • Antibiotic tolerance profiles

  • Cell viability distributions

These multifaceted analyses provide insight into how LrgA influences both the structural development and physiological state of S. aureus biofilms .

What techniques are most effective for studying LrgA-mediated membrane effects?

Investigating LrgA's effects on bacterial membranes requires specialized techniques focusing on membrane integrity, potential, and pore formation:

Membrane Potential Analysis:

  • Voltage-sensitive fluorescent dyes (DiBAC4, DiSC3)

  • Patch-clamp electrophysiology of giant bacterial protoplasts

  • Ion-selective microelectrodes for local potential measurements

Pore Formation Studies:

  • Synthetic vesicle systems: Incorporate purified LrgA into liposomes loaded with fluorescent dyes and monitor leakage

  • Black lipid membrane conductance: Measure ion conductance across artificial membranes containing LrgA

  • Atomic force microscopy: Visualize membrane topography changes associated with LrgA insertion

Protein-Lipid Interaction Analysis:

  • Fluorescence resonance energy transfer (FRET) between labeled LrgA and membrane probes

  • Differential scanning calorimetry to measure membrane phase transitions

  • Lipid binding assays using native and mutant LrgA proteins

Recent research has validated the holin-like function of LrgA using synthetic vesicles. When His-tagged LrgA was incorporated into these vesicles, it caused dye leakage to the extravesicle space, though at a higher protein/lipid ratio than CidA, indicating its less efficient pore-forming capability .

To effectively study LrgA's membrane effects, researchers should:

  • Control lipid composition to match S. aureus membranes

  • Consider the impact of membrane potential on protein function

  • Examine oligomerization states under various membrane conditions

  • Compare wild-type and cysteine mutant proteins for functional differences

These approaches provide mechanistic insight into how LrgA influences membrane integrity and function, thereby controlling both cell death processes and metabolite transport .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.