Recombinant Staphylococcus aureus Capsular polysaccharide biosynthesis protein CapA (capA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Capsular Polysaccharide Biosynthesis Protein CapA (capA)

The capsular polysaccharide (CP) biosynthesis protein CapA (capA) is a critical enzymatic component in Staphylococcus aureus responsible for coordinating capsule assembly with cell wall biosynthesis. Recombinant CapA is a membrane-anchored protein expressed in heterologous systems (e.g., E. coli) with a His-tag for purification, spanning amino acids 1–220/221 . Its dual roles as a kinase activator and phosphodiesterase regulate key enzymatic checkpoints in CP synthesis, ensuring efficient precursor allocation between capsule and peptidoglycan pathways .

Domain Architecture

CapA1 (a CapA variant) features:

  • Two transmembrane domains flanking an extracellular loop (130 amino acids).

  • Catalytic functions:

    • Phosphodiesterase activity: Cleaves pyrophosphate linkages in lipid-linked CP precursors, releasing undecaprenyl-phosphate (C55P), a shared lipid carrier for peptidoglycan and WTA biosynthesis .

    • Kinase activation: Part of the CapAB tyrosine kinase complex, which phosphorylates target enzymes to modulate CP synthesis .

FeatureDescriptionSource
Membrane AnchoringDual transmembrane domains for localization to the cytoplasmic membrane .
Catalytic LoopExtracellular domain processes lipid-linked CP precursors .

Phosphorylation-Dependent Regulation of CP Biosynthesis

The CapAB kinase complex (CapA1B1) dynamically regulates CP synthesis through reversible tyrosine phosphorylation of target enzymes.

Key Phosphorylation Targets

ProteinPhosphorylation SiteFunctional ImpactSource
CapMTyr1574-fold increase in lipid I cap synthesis
CapETyr75, Tyr157Dehydratase activity (unconfirmed effect)
  • CapM: Phosphorylation at Tyr157 is essential for catalytic activation; the Tyr157Phe mutant abolishes CapA1B1-mediated stimulation .

  • CapE: Phosphorylated in vitro, but its regulatory role remains unclear .

Transcriptional Regulation of cap Operon

CapA expression is tightly controlled by overlapping regulators binding to the cap promoter and capA coding region:

RegulatorBinding RegionMechanism of ActionSource
XdrABroad region (−35 promoter to capA)Repression via direct DNA binding
CodYOverlaps XdrA binding sitesEpistatic repression (dominant over XdrA)
RbsR10-bp inverted repeat upstreamActivation through competition for binding
  • XdrA/CodY Interplay: CodY mediates repression downstream of XdrA, as codY overexpression rescues xdrA mutant phenotypes .

  • Regulatory Complexity: The cap promoter is targeted by ≥7 regulators (e.g., KpdE, SpoVG), highlighting its central role in virulence adaptation .

Recombinant Production and Research Applications

Recombinant CapA is produced for studying CP biosynthesis and vaccine development:

ParameterDetailSource
Expression SystemE. coli (His-tagged) or yeast/baculovirus systems .
Purity≥90% (SDS-PAGE verified) .
Applications- Enzymatic assays for CP precursor processing.
- Vaccine antigen studies.

Note: Commercial recombinant CapA is strictly for research use; not intended for human/animal application .

Functional Redundancy vs. Specificity

Kinase ComplexRole in CP BiosynthesisIn Vivo Requirement
CapA1B1Essential for CP synthesisRequired (MW2 strain complementation)
CapA2B2Partial redundancy in vitroNot required (capB2 deletion in Newman)
  • CapA1 vs. CapA2: While CapA1B1 and CapA2B2 share enzymatic targets in vitro, only CapA1B1 is indispensable for capsule formation in vivo .

Coordination with Cell Wall Biosynthesis

CapA1 ensures cross-pathway regulation by:

  1. Liberating C55P: Cleaving lipid-linked CP precursors to recycle C55P for peptidoglycan synthesis .

  2. Sensing Metabolites: The Ser/Thr kinase PknB inhibits CP synthesis when lipid II (peptidoglycan precursor) levels are low, balancing resource allocation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
capA; SA2457; Capsular polysaccharide biosynthesis protein CapA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
capA
Target Protein Sequence
MKEKFDLVKLLNILKKNIKLLLILPAICLVVSTALTFFVMPDKYTASTQILVNMKKSSSD LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS VTTGNKSESDKIVNRISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
Uniprot No.

Target Background

Function

Essential for the biosynthesis of type 1 capsular polysaccharide.

Database Links

KEGG: sau:SA2457

Protein Families
CpsC/CapA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Staphylococcus aureus CapA in capsular polysaccharide biosynthesis?

CapA functions as a dual-function kinase activator/phosphodiesterase protein crucial for signaling and processing of the capsular polysaccharide (CP) polymer. The CapA protein works within the CapAB tyrosine kinase complex to control multiple enzymatic checkpoints through reversible phosphorylation, modulating the consumption of essential precursors that are also used in peptidoglycan biosynthesis . CapA1 specifically interacts with lipid-bound CP precursors and catalyzes the cleavage of the pyrophosphate linkage, releasing the essential lipid carrier undecaprenyl-phosphate (C55P) . This function is critical for coordinating CP synthesis with cell wall biosynthesis.

What is the structural organization of CapA in the bacterial membrane?

CapA1 is anchored to the cytoplasmic membrane via two transmembrane domains flanking an outside loop comprising approximately 130 amino acids. This extracellular domain likely represents a dual-function sensory/catalytic region involved in recognition and processing of membrane-bound CP precursors . The transmembrane anchoring is essential for its proper positioning to interact with both intracellular signaling components and extracellular capsular precursors.

Are there different forms of CapA in Staphylococcus aureus, and do they have distinct functions?

S. aureus possesses two CapA proteins: CapA1 and CapA2. Research has demonstrated that while both proteins can be expressed, CapA1 is significantly more crucial for CP production. Deletion of capA1 substantially reduces capsule synthesis, whereas deletion of capA2 shows minimal effect on CP production in vivo . These findings indicate that despite potential functional redundancy in vitro, the two proteins have distinct physiological roles, with CapA1 being the primary factor in capsule formation.

How is CapA expression regulated during Staphylococcus aureus infection?

The capsular polysaccharide biosynthesis gene cluster in S. aureus is regulated by one principal promoter element Pcap. This promoter contains a main SigB-dependent promoter and a second weak SigA-dependent promoter further upstream . The SigB consensus motif overlaps with a crucial inverted repeat (IR) region essential for cap expression. Additionally, the upstream region functions as a binding site for repressors such as Rot, CodY, and SaeR, which interfere with SigB-dependent promoter activity . This complex transcriptional regulation ensures appropriate temporal and spatial control of CP synthesis.

What are the optimal conditions for expressing recombinant CapA protein in heterologous systems?

For effective expression of recombinant CapA, researchers typically use E. coli, yeast, baculovirus, or mammalian cell expression systems . When using E. coli, the BL21 and C43 strains have proven effective for overexpression of recombinant His6-tagged CapA fusion proteins . Optimal expression conditions include:

  • For E. coli systems: Culture in LB medium supplemented with appropriate antibiotics (50 µg/ml ampicillin or 25 µg/ml kanamycin) at 37°C until mid-log phase, followed by induction with IPTG (typically 0.5-1 mM) for 3-4 hours at 30°C to reduce inclusion body formation.

  • For membrane-associated proteins like CapA1: Lower induction temperatures (16-25°C) and extended expression periods (overnight) often yield better results for properly folded protein.

  • For full-length CapA with transmembrane domains: Consider using specialized detergents during purification to maintain protein solubility and native conformation.

These conditions should be optimized based on the specific construct and expression system used.

How can the phosphodiesterase activity of CapA be measured in vitro?

The phosphodiesterase activity of CapA can be assessed through several methodological approaches:

  • Lipid intermediate hydrolysis assay: Purified CapA1 can be incubated with radiolabeled or fluorescently labeled lipid-linked CP precursors, followed by thin-layer chromatography or HPLC analysis to detect the release of undecaprenyl-phosphate .

  • Coupled enzyme assay: The release of inorganic phosphate during pyrophosphate cleavage can be monitored using commercially available phosphate detection kits or through coupling with enzymes that utilize phosphate in subsequent reactions.

  • Mass spectrometry-based approach: LC-MS/MS can be employed to detect and quantify both substrates (lipid-linked CP precursors) and products (cleaved undecaprenyl-phosphate and released CP components).

Table 1: Reaction components for CapA phosphodiesterase activity assay

ComponentConcentrationFunction
Purified CapA10.5-2 μMEnzyme
Lipid-linked CP precursor50-100 μMSubstrate
MgCl₂5-10 mMCofactor
Buffer (Tris-HCl, pH 7.5)50 mMReaction environment
NaCl100 mMIonic strength
Reaction time15-60 minIncubation at 37°C

What methods are effective for analyzing CapA phosphorylation and its effects on downstream targets?

Analysis of CapA phosphorylation and its effects can be approached through multiple techniques:

  • In vitro phosphorylation assays: Recombinant CapA1B1 complex can be used to assess auto-phosphorylation and trans-phosphorylation of targets like CapM and CapE. This typically involves incubation with [γ-³²P]ATP followed by SDS-PAGE and autoradiography or phosphor-imaging .

  • Phosphosite mapping: Mass spectrometry can identify specific phosphorylation sites. For instance, in silico prediction tools like NetPhos 3.1 identified tyrosines 75 and 157 as putative phosphosites in CapM, with Tyr157 confirmed as the primary regulatory site .

  • Functional assays for phosphorylation effects: To determine how phosphorylation affects activity, researchers can compare enzymatic activities before and after phosphorylation. For example, phosphorylation of CapM by CapA1B1 increased lipid Icap synthesis 4-fold, demonstrating that CapAB-mediated signaling stimulates the priming step of CP biosynthesis .

  • Site-directed mutagenesis: Creating phosphorylation-null (e.g., Y→F) or phosphomimetic (e.g., Y→E) mutations at identified phosphosites helps validate the functional significance of specific phosphorylation events.

  • Phosphospecific antibodies: Development of antibodies specific to phosphorylated forms of CapA or its targets enables monitoring of phosphorylation status in vivo.

How can recombinant CapA be evaluated for potential use in Staphylococcus aureus vaccines?

Evaluation of recombinant CapA for vaccine development involves several methodological steps:

  • Immunogenicity assessment: Determine antibody responses to recombinant CapA in animal models. Previous studies have demonstrated that animals immunized with recombinant S. aureus antigens including CapA can produce functional antibodies that are not typically observed after natural exposure to the pathogen .

  • Functional antibody assays: Develop assays to assess whether antibodies elicited by recombinant CapA can neutralize the protein's function. For example, researchers have developed Fg-binding assays specific for ClfA-mediated binding to evaluate function-blocking antibodies .

  • Protection studies: Evaluate vaccine efficacy in appropriate animal models of S. aureus infection. This should include assessment of bacterial burden, disease severity, and survival rates in vaccinated versus control animals.

  • Adjuvant optimization: Test various adjuvant formulations to enhance immunogenicity. Previous studies have used aluminum-based adjuvants (AlPO₄) or more complex formulations like Iscomatrix .

  • Combination with other antigens: Assess potential synergistic effects when CapA is combined with other S. aureus antigens. Multi-antigen formulations including capsular polysaccharides and surface proteins have shown promise in preclinical studies .

What immune responses are most relevant for protection against CapA-producing Staphylococcus aureus strains?

The most relevant protective immune responses include:

  • Functional antibodies: Antibodies capable of neutralizing CapA's enzymatic activities or blocking its interactions with other biosynthetic proteins are likely important for protection. These functional antibodies should be capable of interfering with capsule biosynthesis.

  • Opsonophagocytic activity: Antibodies that facilitate phagocytosis of encapsulated S. aureus by neutrophils or macrophages are crucial. Assays measuring opsonophagocytic killing can assess this activity.

  • Cell-mediated immunity: T cell responses, particularly Th17 responses, may contribute to protection against S. aureus. Methods to assess antigen-specific T cell activation include intracellular cytokine staining, ELISpot assays, and proliferation assays.

  • Cytokine profiles: Analysis of cytokine responses following vaccination can provide insights into immune polarization. A balanced Th1/Th17 response is often associated with protection against extracellular bacterial pathogens.

A comprehensive immunological assessment should consider both humoral and cellular aspects of immunity, as studies on S. aureus infections suggest that neither alone is sufficient for complete protection.

How can genetic variability in the capA gene among different S. aureus strains be analyzed and its impact on function assessed?

Analysis of capA genetic variability requires a comprehensive approach:

  • Comparative genomics: Whole genome sequencing and comparative analysis of multiple S. aureus strains can reveal polymorphisms in capA. For example, strain MW2 carries a frameshift mutation in capA1 (cap5A) that results in expression of a truncated version (171 aa) of the full-length gene product (222 aa) .

  • PCR amplification and sequencing: Targeted PCR amplification and sequencing of the capA gene from diverse clinical isolates can identify strain-specific variations.

  • Functional impact assessment:

    • Express variant capA genes in capA knockout backgrounds to assess complementation

    • Compare capsule production levels quantitatively

    • Measure enzymatic activities of purified variant proteins

    • Analyze protein-protein interactions between variant CapA proteins and other Cap proteins

  • Bioinformatic analysis: Tools for predicting the impact of amino acid substitutions on protein function (e.g., SIFT, PolyPhen) can provide insights into potentially significant variations.

  • Structural modeling: Homology modeling of variant CapA proteins can predict how amino acid changes might affect protein structure and function.

Research has shown that complementation with pCapA1 in trans enhanced CP production in strain MW2, demonstrating the functional significance of genetic variations in capA .

What are the methodologies for creating capA deletion or modification mutants in S. aureus?

Several methodologies can be employed to create capA mutants:

  • Allelic replacement: This involves creating a construct containing homologous regions flanking the capA gene, interrupted by an antibiotic resistance marker. After transformation, double crossover events lead to replacement of the native gene with the mutant allele.

  • Transposon mutagenesis: Libraries like the Nebraska transposon mutant library contain derivatives of S. aureus strains in which individual nonessential genes have been disrupted by the insertion of the mariner transposon (Tn) bursa aurealis, including mutants in capA1 (NE302a) and capA2 (NE1286) .

  • CRISPR-Cas9 genome editing: This newer approach allows for precise genomic modifications without antibiotic selection markers. It can be used to create complete gene deletions, point mutations, or insertions.

  • Antisense RNA technology: Antisense plasmids (e.g., pEPSA5-capA1AS) can be used to knockdown gene expression when complete deletion is not feasible or desired. These constructs express RNA complementary to the target mRNA, inhibiting translation .

  • Complementation strategies: For phenotype verification, complementation plasmids expressing wild-type capA (e.g., pCapA1) under the control of inducible or constitutive promoters can be introduced into mutant strains.

When working with these mutants, researchers typically maintain them on appropriate selective media (e.g., TSA with 5 µg/ml erythromycin for transposon mutants or 10 µg/ml chloramphenicol for plasmid-complemented strains) .

How does the CapAB tyrosine kinase complex interact with other components of the capsular polysaccharide biosynthesis machinery?

The CapAB tyrosine kinase complex interacts with multiple components through specific mechanisms:

  • Target protein phosphorylation: The CapA1B1 complex phosphorylates specific target proteins involved in CP biosynthesis. Confirmed targets include:

    • The glycosyltransferase CapM (phosphorylated at Tyr157)

    • The dehydratase CapE
      These phosphorylation events modulate enzymatic activities, with phosphorylation of CapM increasing lipid Icap synthesis 4-fold .

  • Interaction with lipid-linked precursors: CapA1 directly interacts with and cleaves lipid-linked CP precursors, releasing the essential lipid carrier undecaprenyl-phosphate (C55P). This dual kinase activator/phosphodiesterase function is crucial for coordinating CP synthesis .

  • Regulatory phosphoprotein network: The CapAB-mediated phosphorylation is antagonized by the PHP class phosphatases CapC1 and CapC2, which can dephosphorylate both CapB kinase and its target proteins, creating a reversible regulatory network .

  • Cross-talk with cell wall biosynthesis: The CapAB complex helps coordinate CP synthesis with peptidoglycan biosynthesis by modulating the consumption of shared precursors, particularly undecaprenyl-phosphate .

Table 2: CapAB complex interactions and effects

Interaction PartnerMechanismFunctional Outcome
CapMPhosphorylation at Tyr1574-fold increase in lipid Icap synthesis
CapETyrosine phosphorylationModulation of dehydratase activity
Lipid-linked CP precursorsDirect binding and cleavageRelease of C55P carrier
CapC1/C2 phosphatasesAntagonistic dephosphorylationReversible regulation
PknBNegative regulationReduced CapA1B1 autokinase activity

How is CapA function coordinated with peptidoglycan synthesis and other cell wall components?

Coordination between CapA function and other cell wall processes occurs through several mechanisms:

  • Shared lipid carrier management: Both CP and peptidoglycan biosynthesis require the essential lipid carrier undecaprenyl-phosphate (C55P). CapA1 hydrolyzes CP lipid intermediates, releasing C55P for use in other pathways, helping to maintain appropriate C55P levels .

  • PknB-mediated negative regulation: The Ser/Thr kinase PknB, which can sense cellular lipid II levels, negatively controls CP synthesis by reducing both CapM glycosyltransferase activity and CapA1B1 autokinase activity. This provides a feedback mechanism that may prioritize peptidoglycan synthesis when lipid II levels are low .

  • LCP protein-mediated attachment: The attachment of CP to the cell wall is achieved by LcpC, a member of the LytR-CpsA-Psr protein family, using the peptidoglycan precursor native lipid II as an acceptor substrate .

  • Metabolic coordination: The biosyntheses of various cell envelope components (peptidoglycan, wall teichoic acid, and CP) must be coordinated since they share enzymatic machineries and precursors. Inhibition of late-stage CP biosynthesis genes can be lethal, similar to the "essential gene paradox" observed in wall teichoic acid biosynthesis, likely due to sequestration of lipid intermediates reducing undecaprenyl-phosphate to levels that affect peptidoglycan synthesis .

  • Rescue mechanism: CapA1-mediated hydrolysis of CP lipid intermediates can serve as a rescue mechanism, counteracting the depletion of C55P to critical levels. This is particularly important when the normal CP attachment process via LCP proteins is compromised, as evidenced by the finding that depletion of CapA1 in a S. aureus Δlcp triple mutant was lethal .

This coordinated regulation ensures that the synthesis of different cell wall components proceeds in a balanced manner, preventing detrimental effects on cell envelope integrity.

What are the recommended approaches for studying CapA-mediated phosphorylation events in real-time within living S. aureus cells?

Studying CapA-mediated phosphorylation in real-time presents technical challenges that can be addressed through several sophisticated approaches:

  • Phospho-specific biosensors: Develop FRET-based biosensors that change conformation upon phosphorylation of target sequences derived from CapA substrates. These can be expressed in S. aureus to visualize phosphorylation dynamics in real-time using fluorescence microscopy.

  • Chemical genetics approaches: Use engineered CapA1B1 variants sensitive to specific small-molecule inhibitors, allowing temporal control over kinase activity in living cells.

  • Phospho-proteomic time-course analysis: Perform rapid cellular fixation at defined timepoints following stimulation of capsule production, followed by phospho-enrichment and quantitative mass spectrometry to identify dynamic changes in phosphorylation status.

  • In situ proximity ligation assays: Detect interactions between CapA and its substrates in fixed cells using antibodies against CapA and potential substrates, providing spatial information about where phosphorylation events occur within the bacterial cell.

  • Genetically encoded phosphorylation reporters: Express fusion proteins containing CapA target sequences linked to fluorescent proteins that relocalize upon phosphorylation, allowing visualization of phosphorylation events.

These approaches can be complemented with genetic manipulations (e.g., phosphosite mutants) to validate the specificity of the signals observed.

How can structural biology techniques be applied to elucidate the molecular mechanisms of CapA function?

Structural biology offers powerful approaches to understand CapA function:

Integration of these approaches can provide a comprehensive understanding of how CapA's structure relates to its dual kinase activator/phosphodiesterase functions in CP biosynthesis.

How might inhibition of CapA function affect S. aureus virulence and survival?

Inhibition of CapA function could affect S. aureus in multiple significant ways:

  • Reduced capsule production: Since CapA1 is crucial for CP synthesis, its inhibition would likely result in reduced capsule formation . This could decrease bacterial resistance to opsonophagocytosis, making bacteria more susceptible to immune clearance.

  • Disrupted cell wall homeostasis: Given CapA's role in releasing the essential lipid carrier undecaprenyl-phosphate (C55P), inhibition might lead to imbalances in C55P availability for various cell wall processes . This could potentially weaken cell wall integrity.

  • Sequestration of lipid intermediates: If CapA's phosphodiesterase activity is inhibited, accumulation of lipid-linked CP precursors could deplete the pool of undecaprenyl-phosphate below critical levels needed for peptidoglycan synthesis, potentially causing cell death through mechanisms similar to the "essential gene paradox" observed with late-stage CP biosynthesis genes .

  • Altered signaling networks: Disruption of CapAB-mediated phosphorylation would affect downstream targets like CapM and CapE, potentially causing dysregulation of multiple aspects of cell envelope biosynthesis .

  • Increased susceptibility to cell wall-targeting antibiotics: Compromised coordination between CP synthesis and peptidoglycan biosynthesis might enhance the effectiveness of β-lactams and other cell wall-active antimicrobials.

The essentiality of CapA1 in certain genetic backgrounds (e.g., in Δlcp triple mutants) suggests that targeted inhibition of CapA could have significant antimicrobial potential, particularly in combination with other therapeutic approaches .

What methodological approaches are recommended for screening potential inhibitors of CapA function?

A comprehensive inhibitor screening campaign should employ multiple approaches:

  • High-throughput enzymatic assays:

    • Phosphodiesterase activity assay: Screen for compounds that inhibit CapA1-mediated cleavage of lipid-linked CP precursors

    • CapA1B1 autophosphorylation assay: Identify compounds that block kinase activity

    • CapM phosphorylation assay: Screen for inhibitors of CapA1B1-mediated phosphorylation of downstream targets

  • Fragment-based screening:

    • NMR-based fragment screening to identify small molecules that bind to CapA

    • X-ray crystallography to determine binding modes of fragments

    • Structure-guided optimization of initial hits

  • Phenotypic screening:

    • Assays measuring capsule production in the presence of potential inhibitors

    • Screens for synergistic compounds that enhance effectiveness of cell wall-active antibiotics

  • In silico approaches:

    • Virtual screening against the ATP-binding site of CapB

    • Molecular docking against the extracellular loop of CapA1

    • Pharmacophore-based screening based on known substrate interactions

  • Target validation methods:

    • Generation of resistance mutants to confirm mechanism of action

    • Testing of inhibitors against phosphosite mutants (e.g., CapM Y157F)

    • Using gene knockdown/overexpression to verify target specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.