Recombinant Staphylococcus aureus Cardiolipin synthase 1 (cls1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cls1; SACOL1351; Cardiolipin synthase 1; CL synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
cls1
Target Protein Sequence
MRFTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWLFVLFVLPLIGFI LYLFFGRTVSARKLNKNNGNVLTDFDGLLKQQIESFDKGNYGTDNKQVQKHHDLVRMLLM DQDGFLTENNKVDHFIDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGLGKRILHALEEKL KQGLEVKILYDDVGSKNVKMANFDHFKSLGGEVEAFFASKLPLLNFRMNNRNHRKIIVID GQLGYVGGFNIGDEYLGLGKLGYWRDTHLRIQGDAVDALQLRFILDWNSQAHRPQFEYDV KYFPKKNGPLGNSPIQIAASGPASDWHQIEYGYTKMIMSAKKSVYLQSPYFIPDNSYINA IKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLSSGVKIYTYENGFIHSKMCLIDDE IVSVGTANMDFRSFELNFEVNAFVYDENLAKDLRVAYEHDITKSKQLTKESYANRPLSVK FKESLAKLVSPIL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase 1 (cls1) in Staphylococcus aureus?

Cardiolipin synthase 1 (cls1) is one of two distinct cardiolipin synthase genes in Staphylococcus aureus, responsible for the synthesis of cardiolipin (CL), a key phospholipid in bacterial membranes. Research shows that cls1 directs the production of Cls1 enzyme, which is specifically responsible for CL synthesis under acid stress conditions . Unlike cls2, which serves as the major CL synthase during normal growth and stationary phase, cls1 plays a specialized role in stress adaptation. Phylogenetic analyses suggest that cls1 emerged through duplication of cls2 after the divergence of the genus Staphylococcus, representing an evolutionary adaptation to enhance survival in acidic environments .

How does cls1 differ functionally from cls2 in S. aureus?

The functional difference between cls1 and cls2 lies primarily in their specific roles and conditions of activation:

Characteristiccls1cls2
Primary functionCL synthesis under acid stressHousekeeping CL synthesis
Activation conditionsAcute low pH (below 2.6)Normal growth, stationary phase, phagocytosis
Response timeRapid (within 5 minutes)Gradual accumulation
Protein synthesis requirementDoes not require de novo protein synthesisMay require new protein synthesis
Impact on total CL levelsMinor impact when deleted aloneMajor impact when deleted

What experimental evidence confirms the role of cls1 in acid stress response?

The role of cls1 in acid stress response has been confirmed through several experimental approaches:

Studies have shown that below pH 2.6, the cls2 mutant (carrying only Cls1) effectively accumulates cardiolipin, while the cls1 mutant (carrying only Cls2) cannot produce cardiolipin . This cls1-dependent cardiolipin production occurs rapidly (within 5 minutes) and does not require de novo protein synthesis, indicating that Cls1 enzyme is constitutively present and can be quickly activated when needed .

How should experiments be designed to study cls1 function in S. aureus?

When designing experiments to study cls1 function, researchers should apply several key principles to ensure robust results:

  • Genetic manipulation controls:

    • Include both single mutants (Δcls1, Δcls2) and double mutant (Δcls1Δcls2)

    • Use complemented strains to verify phenotypes

    • Consider point mutations in catalytic residues as alternatives to whole gene deletion

  • Environmental condition variables:

    • Test multiple pH levels (e.g., pH 7.4, 5.5, 4.0, 2.6)

    • Include time course experiments to capture rapid cls1 responses

    • Examine different growth phases (exponential vs. stationary)

  • Replication and statistical considerations:

    • Use minimum of three biological replicates for each experiment

    • Include technical replicates for measurements

    • Apply appropriate statistical tests based on data distribution

  • Multiparametric analysis:

    • Combine transcriptional, translational, and functional measurements

    • Include both molecular (cardiolipin levels) and phenotypic (acid survival) outcomes

Remember that attempting statistical analysis with only one sample compared to another single sample is a common mistake in experimental design. For meaningful results, a minimum of three samples is needed to achieve adequate statistical power .

What methods are recommended for creating cls1 deletion mutants?

Creating precise cls1 deletion mutants in S. aureus requires careful genetic manipulation:

  • Allelic replacement technique: Use temperature-sensitive plasmids (e.g., pMAD or pIMAY) carrying homologous regions flanking the cls1 gene, with an antibiotic resistance marker between them.

  • Homologous recombination protocol:

    • Transform the construct into S. aureus

    • Integrate the plasmid via single crossover at permissive temperature

    • Select for antibiotic resistance

    • Shift to non-permissive temperature to force second crossover

    • Screen for antibiotic-sensitive colonies (plasmid loss)

    • Confirm deletion by PCR and sequencing

  • Complementation validation: Re-introduce cls1 under its native promoter using a multicopy plasmid (e.g., pOS1) to confirm phenotypes are specifically due to cls1 loss .

The effectiveness of this approach has been demonstrated in research where ectopic expression of cls2 under the control of the native cls promoter using a multicopy plasmid pOS1 fully restored Sae activity of the sae target genes in cls2- and cls1/cls2-mutant strains, but not with cls1 .

How can cardiolipin levels be accurately quantified in S. aureus?

Accurate quantification of cardiolipin levels requires careful sample preparation and analytical techniques:

Sample preparation methods:

  • Bligh and Dyer extraction: Standard chloroform/methanol/water extraction for total lipids

  • Folch method: Alternative using chloroform/methanol (2:1)

Analytical techniques:

TechniqueAdvantagesLimitationsQuantification Method
Thin-layer chromatography (TLC)Simple, low costLower sensitivityDensitometry with standards
LC-MS (liquid chromatography-mass spectrometry)High sensitivity, can identify speciesComplex data analysisInternal standards, peak area
31P NMR spectroscopyNon-destructive, quantitativeLower sensitivityIntegration against standard

This approach has been validated in research where TLC was used to demonstrate that deletion of cls1 did not affect the level of CL noticeably, whereas deletion of cls2 did, and almost no CL was detected in the cls1/cls2 double mutant .

How does cls1 activity affect S. aureus virulence and pathogenicity?

The relationship between cls1 activity and S. aureus virulence is multifaceted:

  • Modulation of virulence regulatory systems: Cardiolipin produced by cls1 (especially under acid stress) affects the activity of the SaeRS two-component system, which regulates numerous virulence factors. Research demonstrates that deletion of both cls1 and cls2 leads to reduced cytotoxicity to human neutrophils and lower virulence in mouse infection models .

  • Virulence gene expression: Studies using promoter-reporter fusions (P1-gfp) show that deletion of cls2 significantly decreases transcript levels of key virulence genes regulated by Sae, including saeQ, coa (coagulase), and hla (α-hemolysin) . While cls1 deletion alone has minimal effect under normal conditions, under acid stress, cls1 becomes critical for maintaining the membrane environment that supports SaeRS signaling.

  • Neutrophil peptide response: Interestingly, while cardiolipin is required for full activity of Sae under normal conditions, it plays only a minor role during human neutrophil peptide 1 (HNP1)-mediated Sae activation. At both exponential (4h) and stationary (24h) growth phases, all cls mutants showed HNP1-induced Sae activation, although the activation levels were somewhat lower in cells lacking both cls1 and cls2 .

What is the relationship between cls1 and two-component regulatory systems?

Research has revealed an important relationship between cardiolipin production by cls1 and the function of two-component systems in S. aureus, particularly the SaeRS system:

How does cls1 contribute to S. aureus survival under stress conditions?

The cls1 gene plays a critical role in S. aureus survival under various stress conditions:

  • Acute acid stress response: Below pH 2.6, the cls1 mutant (carrying only Cls2) cannot produce cardiolipin, while the cls2 mutant (carrying only Cls1) effectively accumulates CL. This indicates that Cls1 remains functional in highly acidic environments where Cls2 activity stalls .

  • Rapid adaptation mechanism: The cls1-dependent cardiolipin production occurs rapidly (within 5 minutes) and does not require de novo protein synthesis, suggesting that Cls1 enzyme is constitutively present and can be quickly activated when needed .

  • Enhanced survival: Phylogenetic analyses suggest that cls1 was generated through the duplication of cls2 after the divergence of the genus Staphylococcus, and that this alternative CL synthase confers improved survival in the face of acute acid stress .

What expression systems are optimal for producing recombinant cls1 protein?

Producing active recombinant Cls1 protein presents challenges due to its membrane-associated nature. Several expression systems can be optimized for this purpose:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3) with pET vectorsHigh yield, well-established protocolsMay require detergent solubilization
E. coli C43(DE3) or C41(DE3)Designed for membrane proteins, reduces toxicityLower yield than standard BL21
Cell-free expression systemsAvoids toxicity issuesHigher cost, smaller scale
Bacillus subtilisMore similar membrane environment to S. aureusLess established tools than E. coli

Optimized protocol elements:

  • Vector design: Include a cleavable His-tag or other affinity tag for purification

  • Expression conditions: Induce at lower temperatures (16-20°C), use lower inducer concentrations

  • Membrane extraction: Use mild detergents (DDM, LMNG, or CHAPS)

  • Purification strategy: IMAC followed by size exclusion chromatography

How can cls1 activity be measured in vitro?

Measuring cls1 activity in vitro requires several complementary approaches:

  • Purified enzyme activity assay: Express and purify recombinant Cls1 protein to measure its enzymatic activity under different pH conditions using:

    • Radioactive substrate incorporation

    • Fluorescent substrate analogs

    • Coupled enzyme assays

  • pH dependence characterization: Determine the pH optimum and range for Cls1 activity in comparison to Cls2. Research indicates that Cls1 remains active at pH levels below 2.6 where Cls2 activity stalls .

  • Substrate specificity analysis: Test various phospholipid substrates to determine Cls1 preference, which may differ from Cls2 based on their specialized functions.

  • Kinetic parameters determination: Calculate Km, Vmax, and catalytic efficiency at different pH values to quantitatively assess how Cls1 enzyme activity changes with pH.

What approaches can be used to study the structure-function relationship of cls1?

Understanding the structure-function relationship of cls1 requires multiple complementary approaches:

  • Homology modeling: Create computational models of Cls1 based on known structures of related enzymes, which can be used to predict:

    • Catalytic residues

    • Substrate binding sites

    • pH-sensing mechanisms

  • Site-directed mutagenesis:

    • Mutate predicted catalytic residues and test activity

    • Create Cls1/Cls2 chimeric proteins to identify domains responsible for acid tolerance

    • Introduce point mutations in potential pH-sensing residues

  • Structural biology techniques:

    • X-ray crystallography of purified Cls1 (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for dynamic regions

  • Functional assays with structural insights:

    • Correlate structural features with enzymatic activity at different pH levels

    • Examine how membrane composition affects Cls1 structure and function

    • Study how cardiolipin binding to other proteins (like SaeS) is influenced by Cls1-specific features

What are the implications of cls1 research for understanding bacterial adaptation?

Research on cls1 has significant implications for understanding bacterial adaptation mechanisms:

  • Evolutionary adaptations: The existence of cls1 as a specialized cardiolipin synthase for acid stress provides insight into how bacteria evolve specialized systems through gene duplication and functional diversification. Phylogenetic analyses suggest that cls1 emerged through duplication of cls2 after the divergence of the genus Staphylococcus .

  • Stress response mechanisms: The rapid, non-protein synthesis-dependent activation of cls1 under acid stress represents an immediate response mechanism that allows bacteria to quickly adapt their membrane composition to environmental challenges .

  • Host-pathogen interactions: The modulation of virulence systems (like SaeRS) by cardiolipin produced by cls1 and cls2 demonstrates how membrane lipid composition serves as a link between environmental sensing and virulence regulation .

What potential applications might arise from understanding cls1 function?

Understanding cls1 function could lead to several potential applications:

  • Novel antimicrobial targets: Cls1 could represent a target for developing antimicrobials that specifically inhibit S. aureus adaptation to acidic environments encountered during infection.

  • Antibiotic potentiators: Inhibitors of Cls1 might serve as adjuvants to enhance the efficacy of existing antibiotics against S. aureus, particularly in acidic microenvironments or biofilms.

  • Diagnostic markers: The differential expression or activity of cls1 under specific conditions might serve as a diagnostic marker for S. aureus stress states or virulence potential.

  • Biotechnological applications: Understanding how Cls1 maintains activity at extremely low pH could inform the design of enzymes for industrial processes requiring acid tolerance.

What statistical approaches are most appropriate for analyzing cls1 activity data?

Analyzing cls1 activity data requires careful selection of statistical approaches:

  • For comparing cls1 activity across different conditions:

    • ANOVA followed by post-hoc tests (Tukey or Bonferroni) for normally distributed data

    • Kruskal-Wallis followed by Dunn's test for non-normally distributed data

    • Two-way ANOVA for examining interactions (e.g., pH × growth phase)

  • For time course experiments of cls1 response:

    • Repeated measures ANOVA or mixed-effects models

    • Area under curve (AUC) analysis followed by appropriate comparison tests

  • For correlating cls1 activity with phenotypic outcomes:

    • Pearson correlation for normally distributed data

    • Spearman correlation for non-parametric relationships

    • Multiple regression to account for confounding factors

Remember that when reporting results, include appropriate measures of variability (standard deviation, standard error, or confidence intervals) and exact p-values rather than threshold indicators (p<0.05) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.