Recombinant Staphylococcus aureus Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
cls; SAS1992; Cardiolipin synthase; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Staphylococcus aureus (strain MSSA476)
Target Names
cls
Target Protein Sequence
MIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMERRSANSIWAWLLVLVFLPLFGF ILYLLLGRQIQRDQIFKIDKEDKKGLELIVDEQLAALKNENFSNSNYQIVKFKEMIQMLL YNNAAFLTTDNDLKIYTDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKK AEQGVEVKILYDDMGSRGLRKKGLRPFRNKGGHAEAFFPSKLPLINLRMNNRNHRKIVVI DGQIGYVGGFNVGDEYLGKSKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQATRDHISY DDRYFPDVNSGGTIGVQIASSGPDEEWEQIKYGYLKMISSAKKSIYIQSPYFIPDQAFLD SIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLDAGVKVFHYDNGFLHSKTLVIDD EIASVGTANMDHRSFTLNFEVNAFIYDQQIAKKLKQAFIDDLAVSSELTKARYAKRSLWI KFKEGISQLLSPIL
Uniprot No.

Target Background

Function

This enzyme catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links

KEGG: sas:SAS1992

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the cardiolipin synthase genes in S. aureus and how are they identified?

S. aureus possesses two open reading frames (ORFs) that encode proteins with approximately 30% identity to the principal cardiolipin synthase (cls) of Escherichia coli. These two genes, designated as cls1 and cls2, have been identified in all sequenced strains of S. aureus and encode functional cardiolipin synthases that catalyze the condensation of two phosphatidylglycerol (PG) molecules to yield cardiolipin and glycerol . These enzymes belong to the phospholipase D class of enzymes and share key residues that form the catalytic site of these enzymes .

What is the biochemical function of cardiolipin synthases in S. aureus?

Cardiolipin synthases in S. aureus catalyze the condensation reaction of two phosphatidylglycerol (PG) molecules to produce cardiolipin (CL) and glycerol. This enzymatic activity results in significant membrane phospholipid remodeling during specific bacterial growth phases and stress conditions. The conversion from PG to CL is particularly notable during the transition from logarithmic to stationary phase and following phagocytosis by neutrophils, suggesting these enzymes play important roles in bacterial adaptation to environmental stresses .

What are the optimal expression systems for producing recombinant S. aureus Cls proteins?

For expressing recombinant S. aureus Cls proteins, both homologous and heterologous expression systems can be employed. In heterologous expression, E. coli strains lacking the native cls gene have been successfully used to express functionally active S. aureus Cls1 and Cls2, demonstrating that both proteins can catalyze CL accumulation in the stationary phase . For homologous expression, plasmid-based systems with inducible promoters can be utilized in S. aureus, though care must be taken to account for the native regulation of these enzymes.

The methodology typically involves:

  • PCR amplification of cls1 and cls2 genes from S. aureus genomic DNA

  • Cloning into appropriate expression vectors with suitable promoters and selection markers

  • Transformation into the chosen expression host

  • Induction of protein expression under optimal conditions

  • Verification of functional activity through phospholipid analysis

What purification methods are most effective for isolating recombinant S. aureus Cls proteins?

Effective purification of recombinant S. aureus Cls proteins requires consideration of their membrane-associated nature. A methodological approach includes:

  • Cell lysis using methods that effectively disrupt bacterial membranes (sonication or French press)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or Triton X-100)

  • Affinity chromatography utilizing fusion tags (His-tag, Strep-tag) incorporated into the recombinant protein

  • Size-exclusion chromatography for further purification and buffer exchange

  • Verification of purity through SDS-PAGE and Western blotting

For activity studies, it's crucial to ensure that the purification process preserves the enzyme's functional properties, which may require the inclusion of stabilizing agents or reconstitution into lipid vesicles.

How do the activities of Cls1 and Cls2 differ during S. aureus growth phases?

The two cardiolipin synthases in S. aureus exhibit distinct contributions to cardiolipin accumulation during different growth phases. Experimental evidence shows that Cls2 is primarily responsible for cardiolipin accumulation during the stationary phase, while both Cls1 and Cls2 contribute to cardiolipin accumulation following phagocytosis by neutrophils . These differences suggest that the two enzymes have distinct roles and regulatory mechanisms within the bacterial cell.

The differential activity can be experimentally demonstrated by:

  • Creating isogenic single and double mutants lacking cls1, cls2, or both genes

  • Analyzing phospholipid profiles at different growth phases using thin-layer chromatography or mass spectrometry

  • Quantifying cardiolipin levels in each strain under various growth conditions

What experimental approaches can measure the kinetic parameters of recombinant S. aureus Cls enzymes?

To determine the kinetic parameters of recombinant S. aureus Cls enzymes, researchers can employ several methodological approaches:

  • Radiometric assays: Using radiolabeled substrates (e.g., [14C]-PG) to measure the formation of radiolabeled cardiolipin over time under varying substrate concentrations.

  • Fluorescence-based assays: Utilizing fluorescently-labeled PG analogs to monitor the reaction progress in real-time.

  • HPLC or mass spectrometry-based methods: Quantifying substrate depletion and product formation to calculate reaction rates.

  • Coupled enzyme assays: Measuring the release of glycerol (a byproduct of the condensation reaction) using glycerol kinase and glycerol-3-phosphate dehydrogenase coupled with NAD+ reduction, which can be monitored spectrophotometrically.

For all approaches, it's essential to:

  • Establish optimal reaction conditions (pH, temperature, ionic strength)

  • Determine substrate specificity using different phospholipids

  • Calculate Km, Vmax, and kcat values using appropriate enzyme kinetics models

  • Evaluate the effects of potential inhibitors or activators

How can mutagenesis studies identify critical residues in S. aureus Cls enzymes?

Site-directed mutagenesis offers a powerful approach to identify critical residues in S. aureus Cls enzymes. Based on sequence homology with other cardiolipin synthases and phospholipase D family enzymes, researchers can target conserved motifs, particularly those containing the catalytic HKD motifs characteristic of this enzyme family .

A methodological workflow includes:

  • Sequence alignment of S. aureus Cls1 and Cls2 with characterized cardiolipin synthases from other bacteria to identify conserved residues

  • Design of site-directed mutagenesis primers targeting specific amino acids

  • PCR-based mutagenesis of the recombinant cls genes

  • Expression of mutant proteins in a cls-deficient background

  • Enzymatic activity assays comparing wild-type and mutant enzymes

  • Structural analysis to correlate functional changes with specific structural elements

Key residues to target include those in the HKD motifs, which form the catalytic site, as well as residues potentially involved in substrate binding or protein-membrane interactions.

How do environmental stressors affect the expression and activity of S. aureus Cls enzymes?

Environmental stressors significantly influence the expression and activity of S. aureus Cls enzymes, ultimately affecting cardiolipin levels in the bacterial membrane. Key environmental conditions known to impact Cls function include:

  • Growth phase transition: The shift from logarithmic to stationary phase triggers significant cardiolipin accumulation, primarily through Cls2 activity .

  • Phagocytosis by neutrophils: Upon ingestion by human neutrophils, S. aureus rapidly converts PG to CL, with both Cls1 and Cls2 contributing to this response .

  • Osmotic stress: Changes in osmolarity can induce cardiolipin synthesis, potentially as a membrane-stabilizing mechanism.

  • Energy deprivation: Nutrient limitation and energy stress conditions promote cardiolipin accumulation .

Methodologically, researchers can investigate these responses by:

  • Exposing S. aureus cultures to controlled stress conditions

  • Monitoring changes in cls1 and cls2 expression using qRT-PCR or reporter gene fusions

  • Analyzing phospholipid composition changes via thin-layer chromatography or mass spectrometry

  • Comparing wild-type and cls-mutant strains to determine the specific contributions of each enzyme

What molecular mechanisms regulate the differential activities of Cls1 and Cls2 during infection?

The differential activities of Cls1 and Cls2 during infection suggest distinct regulatory mechanisms controlling these enzymes. Although the precise molecular details remain to be fully elucidated, several regulatory possibilities can be investigated:

  • Transcriptional regulation: Different promoter elements and transcription factors may control cls1 and cls2 expression in response to specific environmental signals. Stress-responsive sigma factors might preferentially activate one gene over the other.

  • Post-transcriptional regulation: mRNA stability or ribosome binding efficiency could differ between the two genes, affecting protein production levels.

  • Post-translational modification: Differential phosphorylation, proteolytic processing, or other modifications might alter enzyme activity in response to environmental cues.

  • Substrate availability: Localized changes in PG concentration or accessibility might affect the relative activities of the two enzymes.

  • Protein-protein interactions: Association with different protein partners could modulate enzyme activity in response to specific conditions.

Experimental approaches to investigate these mechanisms include:

  • Transcriptional profiling using RNA-seq under various conditions

  • Promoter-reporter fusions to monitor transcriptional responses

  • Proteomic analyses to identify post-translational modifications

  • Protein-protein interaction studies using pull-down assays or bacterial two-hybrid systems

How does cardiolipin synthesis contribute to S. aureus survival within host cells?

Cardiolipin synthesis appears to play a critical role in S. aureus adaptation to the intracellular environment of host cells, particularly within phagocytes. The rapid conversion of PG to CL following phagocytosis by neutrophils suggests this membrane remodeling is part of the bacterial stress response . Potential mechanisms by which cardiolipin synthesis promotes bacterial survival include:

  • Membrane stabilization: Cardiolipin's unique structure can stabilize bacterial membranes against antimicrobial components of phagocytes.

  • Resistance to antimicrobial peptides: The altered membrane composition may reduce the effectiveness of host defense peptides.

  • Adaptation to acidic environments: Cardiolipin can buffer against the acidic environment of phagolysosomes.

  • Support for respiratory chain function: Cardiolipin interacts with numerous membrane proteins, potentially optimizing energy generation under stress conditions.

  • Modulation of membrane potential: Changes in membrane phospholipid composition can affect bacterial membrane potential, potentially influencing susceptibility to certain antibiotics.

Experimental approaches to investigate these mechanisms include comparing wild-type and cls1/cls2 mutant strains in:

  • Neutrophil or macrophage survival assays

  • Resistance to host antimicrobial peptides

  • Adaptation to acidic pH

  • Respiratory chain function under stress conditions

Is there a connection between cardiolipin synthase activity and antibiotic resistance in S. aureus?

Evidence suggests potential connections between cardiolipin synthase activity and antibiotic resistance in S. aureus. The experimental evolution study in search result identified an evolved S. aureus lineage with increased survival in macrophages and resistance to vancomycin . While this study did not directly implicate cardiolipin synthases, the membrane remodeling function of these enzymes makes them potential contributors to antibiotic resistance mechanisms, particularly those targeting cell envelope integrity.

Researchers can investigate this connection through:

  • Comparing antibiotic susceptibility profiles of wild-type and cls mutant strains

  • Analyzing changes in cardiolipin levels in strains with acquired antibiotic resistance

  • Testing for synergistic effects between Cls inhibitors and conventional antibiotics

  • Examining the impact of cardiolipin synthesis on specific resistance mechanisms, such as:

    • Cell wall thickness

    • Membrane permeability

    • Drug efflux pump function

    • Cell division processes

The potential relationship between cardiolipin synthesis and antibiotic resistance represents an important area for further investigation, potentially opening new avenues for combination therapies targeting resistant S. aureus strains.

What are the latest structural biology approaches for characterizing S. aureus Cls proteins?

Advanced structural biology techniques offer powerful tools for characterizing S. aureus Cls proteins at the molecular level:

  • X-ray crystallography: Though challenging with membrane proteins, this technique can provide atomic-resolution structures when proteins are successfully crystallized, often using lipidic cubic phase methods for membrane proteins.

  • Cryo-electron microscopy (cryo-EM): Single-particle cryo-EM has revolutionized membrane protein structural biology, potentially allowing visualization of Cls proteins in different conformational states without the need for crystallization.

  • Nuclear Magnetic Resonance (NMR) spectroscopy: Solution or solid-state NMR can provide information on protein dynamics and ligand binding, especially for specific domains or in membrane mimetic systems.

  • Molecular dynamics simulations: Computational approaches can model protein-membrane interactions and conformational changes during the catalytic cycle, complementing experimental structural data.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map protein dynamics and structural changes upon substrate binding or interactions with membrane components.

  • Small-angle X-ray scattering (SAXS): Provides information about protein shape and conformational changes in solution.

Implementation requires careful consideration of the membrane environment, potentially using nanodiscs, liposomes, or detergent micelles to maintain protein structure and function during analysis.

How can advanced genetic approaches be used to study S. aureus Cls function in vivo?

Modern genetic approaches offer sophisticated tools for investigating S. aureus Cls function in the context of living bacterial cells and during infection:

  • CRISPR-Cas9 genome editing: Enables precise modification of cls genes, introducing point mutations to specific catalytic residues or regulatory elements without polar effects on downstream genes.

  • Inducible expression systems: Tightly controlled promoters allow temporal regulation of cls expression to study the immediate effects of altering cardiolipin synthesis.

  • Fluorescent protein fusions: Can track the subcellular localization and dynamics of Cls proteins under various conditions, though care must be taken to ensure fusion proteins retain functionality.

  • Single-cell analysis: Techniques like fluorescence microscopy combined with microfluidics can reveal heterogeneity in cardiolipin synthesis within bacterial populations.

  • In vivo reporters: Biosensors that respond to changes in membrane properties can indirectly monitor the effects of cardiolipin synthesis in real-time.

  • Transposon sequencing (Tn-seq): Can identify genetic interactions with cls genes by screening for genes that become essential or dispensable in cls mutant backgrounds.

The experimental evolution approach described in search result represents another sophisticated genetic strategy to understand bacterial adaptation, potentially revealing unexpected connections between cardiolipin synthesis and other cellular processes .

What are the current limitations in studying recombinant S. aureus Cls enzymes?

Several technical challenges complicate the study of recombinant S. aureus Cls enzymes:

  • Membrane protein expression: As integral membrane proteins, Cls enzymes can be difficult to express at high levels in functional form, often forming inclusion bodies or causing toxicity to the expression host.

  • Purification challenges: Maintaining enzyme activity during extraction from membranes and subsequent purification steps requires careful optimization of detergents and buffer conditions.

  • Assay limitations: In vitro activity assays may not fully recapitulate the complex membrane environment in which these enzymes naturally function, potentially affecting kinetic parameters and substrate specificity.

  • Structural analysis difficulties: The membrane-associated nature of these enzymes makes them challenging targets for structural biology techniques.

  • Functional redundancy: The presence of two cardiolipin synthases with overlapping functions requires careful genetic manipulation to dissect their individual roles.

  • Regulatory complexity: The different regulatory mechanisms controlling Cls1 and Cls2 under various conditions add complexity to experimental design and interpretation.

What are promising future research directions for S. aureus cardiolipin synthases?

Emerging research directions for S. aureus cardiolipin synthases include:

  • Development of specific inhibitors: Designing selective inhibitors of Cls1 and Cls2 could provide valuable research tools and potential therapeutic leads against S. aureus infections.

  • Systems biology approaches: Integrating transcriptomics, proteomics, and lipidomics to understand the broader consequences of cardiolipin synthesis in bacterial physiology and pathogenesis.

  • Host-pathogen interaction studies: Further investigating how cardiolipin synthesis contributes to bacterial survival in different host environments and cell types.

  • Structural biology advances: Pursuing high-resolution structures of S. aureus Cls enzymes to understand their catalytic mechanism and inform structure-based drug design.

  • Combination therapy approaches: Exploring how modulation of cardiolipin synthesis might sensitize bacteria to existing antibiotics, potentially overcoming resistance mechanisms.

  • Evolutionary perspectives: Investigating how cardiolipin synthases have evolved across bacterial species and whether their functions have diversified.

  • Metabolic engineering applications: Exploring how controlled manipulation of cardiolipin synthesis might be used in biotechnology applications requiring engineered bacterial membranes.

How might targeting cardiolipin synthesis offer new antimicrobial strategies against S. aureus?

Targeting cardiolipin synthesis presents several potential antimicrobial strategies against S. aureus:

  • Direct enzyme inhibition: Developing small molecule inhibitors that specifically target Cls1 and/or Cls2, potentially disrupting membrane integrity or stress responses.

  • Sensitization to existing antibiotics: Cls inhibitors might synergize with antibiotics that target the cell envelope, particularly in strains with reduced susceptibility to these drugs.

  • Anti-virulence approach: Rather than directly killing bacteria, targeting cardiolipin synthesis might reduce bacterial survival within host cells, limiting pathogenesis without imposing strong selective pressure for resistance.

  • Biofilm disruption: Altered membrane phospholipid composition might affect biofilm formation or stability, potentially enhancing antibiotic penetration into biofilms.

  • Host defense enhancement: Understanding how cardiolipin synthesis contributes to evasion of host defenses might reveal strategies to enhance immune clearance of S. aureus.

Challenges to these approaches include:

  • Developing inhibitors with sufficient specificity for bacterial enzymes

  • Ensuring adequate penetration of inhibitors into bacterial cells

  • Understanding the consequences of partial vs. complete inhibition of cardiolipin synthesis

  • Addressing potential redundancy or compensatory mechanisms

What are the most effective methods for analyzing phospholipid composition in S. aureus?

Several complementary techniques provide comprehensive analysis of phospholipid composition in S. aureus:

  • Thin-layer chromatography (TLC): A relatively simple technique for separating and quantifying major phospholipid species. One-dimensional TLC can separate PG and CL, while two-dimensional TLC provides better resolution of complex mixtures. Phospholipids can be visualized using molybdenum blue spray, iodine vapor, or specific lipid stains.

  • Mass spectrometry-based approaches:

    • Electrospray ionization mass spectrometry (ESI-MS) for molecular species identification

    • Tandem mass spectrometry (MS/MS) for structural characterization

    • Liquid chromatography-mass spectrometry (LC-MS) for separation and quantification of complex mixtures

  • 31P Nuclear Magnetic Resonance (NMR) spectroscopy: Provides quantitative information about phospholipid head groups without destructive sample preparation.

  • Fluorescent probes: Specific dyes like 10-N-nonyl acridine orange (NAO) can selectively bind cardiolipin, allowing visualization and potentially quantification through fluorescence microscopy or flow cytometry.

The methodological workflow typically involves:

  • Careful extraction of total lipids from bacterial cultures

  • Separation of phospholipid classes

  • Identification and quantification of individual species

  • Comparison across experimental conditions or between strains

How can experimental evolution approaches reveal insights about cardiolipin synthase function?

Experimental evolution, as described in search result , offers a powerful approach to understanding cardiolipin synthase function in S. aureus. This methodology involves:

  • Serial passaging under selective conditions: Repeatedly exposing bacteria to specific environments (such as macrophage intracellular conditions) that might favor alterations in cardiolipin synthesis .

  • Whole-genome sequencing: Identifying genetic changes that emerge during adaptation, potentially including mutations in cls genes or their regulators .

  • Phenotypic characterization: Analyzing evolved strains for changes in phospholipid composition, stress resistance, antibiotic susceptibility, and virulence properties .

  • Genetic reconstruction: Introducing identified mutations into parent strains to confirm their phenotypic effects.

  • Transcriptomic and proteomic analysis: Examining how gene expression patterns change in evolved strains, potentially revealing regulatory networks involving cardiolipin synthases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.