Recombinant Staphylococcus aureus DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Functional Roles in S. aureus

FtsK orchestrates critical processes in S. aureus:

  • Chromosome Segregation: Coordinates DNA translocation across the septum during cell division .

  • Cell Cycle Regulation: Maintains Sle1 peptidoglycan hydrolase levels by interacting with trigger factor (TF), ensuring timely septum splitting .

    • Mechanism: FtsK establishes a septal TF gradient, promoting Sle1 export while inhibiting ClpXP-mediated degradation .

  • Stress Response: Halts premature septum splitting under DNA damage by dissipating the TF gradient .

Research Applications

Recombinant FtsK is pivotal for:

  • Mechanistic Studies: Unraveling DNA translocase activity and divisome interactions .

  • Antimicrobial Development: Targeting FtsK to disrupt cell division in MRSA .

  • Vaccine Research: Investigated as a potential antigen due to its surface exposure in S. aureus .

Table 1: Functional Insights from Recent Studies

Study FocusFindingsSource
TF-Sle1 InteractionFtsK stabilizes Sle1 via TF, preventing degradation by ClpXP proteases.
DNA Damage ResponseFtsK delays septum splitting during replication stress.
Localization DynamicsForms a septal ring, guiding chromosome segregation.

Future Directions

  • Structural Resolution: Cryo-EM studies to map FtsK-TF binding interfaces .

  • Therapeutic Targeting: Screening FtsK inhibitors to combat MRSA infections .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; SAV1276; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-788
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
ftsK
Target Protein Sequence
MAQAKKKSTAKKKTASKKRTNSRKKKNDNPIRYVIAILVVVLMVLGVFQLGIIGRLIDSF FNYLFGYSRYLTYILVLLATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNSGIK AEREPVLSYVYQSYQHSHFPNFGGGVLGFYLLELSVPLISLFGVCIITILLLCSSVILLT NHQHRDVAKVALENIKAWFGSFNEKMSERNQEKQLKREEKARLKEEQKARQNEQPQIKDV SDFTEVPQERDIPIYGHTENESKSQCQPSRKKRVFDAENSSNNIVNHQADQQEQLTEQTH NSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVLENTLKDFGVNA KVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVGIEVP NEKISLVSLKEVLDEKFPSNNKLEVGLGRDISGDPITVPLNEMPHLLVAGSTGSGKSVCI NGIITSILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIVAEME RRYDLFQHSSTRNIKGYNELIRKQNQELDEKQPELPYIVVIVDELADLMMVAGKEVENAI QRITQMARAAGIHLIVATQRPSVDVITGIIKNNIPSRIAFAVSSQTDSRTIIGTGGAEKL LGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVEQQQANYVKEMEPDAPVDKSEMK SEDALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLERNQVIGPQKGSKPRQVL IDLNNDEV
Uniprot No.

Target Background

Function
FtsK is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell-division machinery. The C-terminus acts as a DNA motor that moves double-stranded DNA in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. This protein is required for the activation of the Xer recombinase, enabling the activation of chromosome unlinking through recombination.
Database Links

KEGG: sav:SAV1276

STRING: 158878.SAV1276

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of S. aureus FtsK and how does it differ from homologs in other bacteria?

S. aureus FtsK localizes as a ring at the leading edge of the division septum, similar to other divisome proteins. Unlike some bacterial homologs such as E. coli FtsK, the S. aureus protein does not contain membrane-spanning domains, more closely resembling B. subtilis SftA. The protein contains an N-terminal domain with currently unknown function and a C-terminal domain with DNA translocase activity .

The N-terminal domain functions independently of the DNA translocase domain, as evidenced by the fact that deletion of the complete ftsK gene results in severe morphological and cell division defects, while mutants lacking only the C-terminal domain display milder phenotypes . This structure allows S. aureus FtsK to coordinate chromosome dynamics with cell division processes through both its physical presence at the septum and its translocase activity.

When studying S. aureus FtsK structure, researchers should consider using structural prediction tools alongside crystallography approaches to elucidate domain-specific functions, particularly for the poorly characterized N-terminal region.

How does FtsK assemble on DNA and what triggers its translocation activity?

FtsK assembles stepwise on DNA to form a single functional hexamer. Using tethered fluorophore motion (TFM) techniques with two spectrally distinct fluorophores, researchers have observed that after assembly, FtsK begins translocation rapidly, within approximately 0.25 seconds .

The assembly process is specific and regulated, as premature or improper assembly could interfere with DNA metabolism. Once assembled, the FtsK hexamer can translocate along DNA without extruding loops, approaching target sites such as XerCD-dif complexes . When it encounters these complexes, FtsK typically resides at the site for approximately 0.5 seconds before dissociating, rather than reversing direction .

For experimental protocols, researchers should consider using dual-color single-molecule fluorescence techniques to simultaneously track both FtsK assembly and DNA dynamics, which provides greater insights than traditional biochemical approaches.

What role does the C-terminal domain of FtsK play in DNA translocation?

The C-terminal domain of FtsK (FtsKC) possesses DNA translocase activity that enables the protein to move along DNA and interact with DNA-bound proteins. Single-molecule experiments have revealed that FtsKC can push, evict, and bypass proteins bound to DNA during translocation .

Importantly, FtsKC stops when it encounters specific complexes like XerCD-dif, where it activates recombination before dissociating. This finding contrasts with earlier reports suggesting that FtsK can reverse spontaneously during translocation or upon encountering XerCD-dif .

To accurately characterize FtsKC translocation dynamics, researchers should employ single-molecule techniques rather than ensemble approaches, as the latter may mask the heterogeneity in translocation behavior among individual hexamers.

How does FtsK coordinate chromosome segregation with septum splitting in S. aureus?

FtsK coordinates chromosome segregation with septum splitting through its interaction with the trigger factor (TF) chaperone and regulation of the peptidoglycan hydrolase Sle1. In S. aureus, FtsK establishes a TF concentration gradient that is higher in the septal region .

This TF gradient is critical because trigger factor binds to Sle1 and:

  • Promotes its preferential export at the septal region

  • Prevents Sle1 degradation by the ClpXP proteolytic machinery

When DNA replication or segregation is impaired, such as during DNA damage, the TF gradient dissipates and Sle1 levels decrease, halting premature septum splitting . This coordinated mechanism ensures that chromosome segregation precedes daughter cell separation, preventing catastrophic division events that could damage the chromosome.

What phenotypes are observed in S. aureus FtsK mutants and what do they reveal about protein function?

S. aureus FtsK null mutants display several distinct phenotypes that provide insights into its function:

  • Formation of cell clusters and tetrads, indicating delayed daughter cell separation

  • Increased frequency of cells in phase 3 of the S. aureus cell cycle (cells with complete septa undergoing maturation)

  • Electron microscopy reveals pairs of cells connected by a complete septum, each undergoing a second round of division

These phenotypes are similar to those observed in Sle1 mutants, supporting the functional connection between FtsK and Sle1 in cell separation. Interestingly, external addition of Sle1 to FtsK mutants reduces the frequency of tetrads and phase 3 cells, but does not completely restore normal cell cycle progression . This indicates that while cell splitting defects in FtsK mutants are partially mediated by lack of Sle1 at the external surface, FtsK likely has additional roles in cell cycle regulation.

How does FtsK prevent aberrant division events in S. aureus?

FtsK prevents aberrant division by ensuring proper coordination between DNA replication/segregation and septum splitting. Recent research has also revealed interactions between FtsK and other cell division regulation proteins. For instance, a newly characterized protein called FacZ (Factor preventing extra Z-rings) interacts with GpsB, which forms an interaction hub bridging envelope biogenesis factors with the cytokinetic ring in S. aureus .

While not directly discussed in the search results, this suggests a complex regulatory network involving FtsK and other divisome components. Understanding these interactions is crucial for developing comprehensive models of S. aureus cell division regulation and identifying potential targets for antimicrobial development.

How does FtsK interact with trigger factor (TF) and what is the significance of this interaction?

FtsK interacts with trigger factor (TF) through its N-terminal and/or linker domains, as confirmed by co-immunoprecipitation assays . This interaction is functionally significant for several reasons:

  • FtsK establishes a TF concentration gradient that is higher in the septal region

  • This gradient is maintained in cells expressing just the N-terminal domain of FtsK

  • The gradient is absent in cells lacking FtsK

The interaction between FtsK and TF is crucial for regulating Sle1 levels and localization. TF binds Sle1 and promotes its preferential export at the septal region while protecting it from degradation by the ClpXP proteolytic machinery . This mechanism ensures that septum splitting occurs at the appropriate time in the cell cycle, after DNA replication and segregation are complete.

For experimental investigation of this interaction, researchers should consider combining co-immunoprecipitation with fluorescence microscopy techniques to visualize the TF gradient in relation to FtsK localization.

What is the mechanism by which FtsK activates XerCD-dif recombination?

FtsK activates XerCD-dif recombination through a direct interaction with the recombination complex. Single-molecule studies using the tethered fluorophore motion technique reveal that:

  • Single FtsK hexamers approach XerCD-dif and reside there for approximately 0.5 seconds, regardless of whether XerCD-dif is synapsed or unsynapsed

  • FtsK then dissociates rather than reversing direction

  • When encountering a preformed synaptic complex, FtsK can activate XerCD-dif recombination

  • FtsK dissociates before recombination is completed

This suggests that each FtsK-XerCD-dif encounter activates only one round of recombination. The activation mechanism likely involves FtsK inducing conformational changes in the XerCD-dif complex that trigger XerD-mediated strand exchange to form a Holliday junction, which is then resolved by XerC-mediated strand exchange .

How do bacterial stress responses affect FtsK activity and cell division coordination?

When bacteria encounter stress conditions that lead to paused septum synthesis, such as DNA damage or impaired DNA replication/segregation, the FtsK-dependent TF gradient is dissipated and Sle1 levels are reduced . This response halts premature septum splitting, preventing cell separation before chromosomal issues are resolved.

The metabolic state of S. aureus also influences its intracellular behavior. During infection of macrophages, S. aureus transitions from a high metabolic state to a low metabolic dormant-like state by downregulating major energy-consuming processes while remaining viable . This transition appears to be driven by the level of stress encountered in the intracellular niche rather than host cell heterogeneity.

Understanding these stress-responsive mechanisms is crucial for designing experimental approaches that accurately capture FtsK's physiological role and for developing targeted antimicrobial strategies.

What single-molecule techniques are most effective for studying FtsK assembly and translocation dynamics?

The most effective single-molecule technique for studying FtsK dynamics is the expanded tethered fluorophore motion (TFM) approach, which can be combined with Förster resonance energy transfer (FRET). This technique has been specifically used to:

  • Monitor two effective lengths along the same tethered DNA molecule using two spectrally distinct fluorophores

  • Directly observe FtsK assembly into a single hexamer and its subsequent rapid translocation

  • Track FtsK as it approaches XerCD-dif without extruding DNA loops

  • Determine that FtsK resides at XerCD-dif for approximately 0.5 seconds before dissociating

  • Confirm that FtsK activates XerCD-dif recombination when encountering preformed synaptic complexes

This technique represents an advancement over previous methods that could not simultaneously track multiple components in complex multistep reactions. For reliable results, researchers should ensure high-quality protein preparations with minimal aggregation and use appropriate buffer conditions that promote hexamer formation without artificial stabilization.

How can researchers monitor FtsK activity in living bacterial cells?

For monitoring FtsK activity in living cells, researchers can adapt the photoconvertible reporter system used for bacterial metabolic activity. While the search results specifically discuss using the mKikumeGR system for tracking S. aureus metabolic states within macrophages , similar approaches could be applied to monitor FtsK dynamics.

This system would allow researchers to:

  • Visualize FtsK localization and movement in real-time

  • Correlate FtsK activity with cell cycle progression

  • Examine how FtsK function changes under different growth conditions or stress responses

For implementing this approach, researchers should consider creating fusion proteins where the photoconvertible reporter is attached to FtsK without disrupting its function, perhaps through a flexible linker at either the N-terminus or between domains.

What are the key considerations when designing research questions about FtsK function?

When formulating research questions about FtsK function, researchers should follow several key principles:

  • Ensure clarity in the question's formulation so the audience can understand what is being investigated

  • Check that the question is informed by existing literature and addresses gaps in knowledge

  • Consider whether the question is practical to answer with available techniques and resources

  • Be cautious with questions about causality, which can be difficult to prove in complex biological systems

  • Focus on "how" questions or those exploring "to what extent" something occurs rather than broad "why" questions4

For FtsK specifically, researchers should consider whether their questions address the protein's structure-function relationships, its interactions with other cellular components, or its role in coordinating multiple cellular processes. Questions should also be designed with consideration of appropriate experimental approaches, such as single-molecule techniques for mechanistic studies or genetic approaches for functional analyses.

What are the unresolved questions regarding FtsK's role in antibiotic resistance and persistent infections?

Several unresolved questions remain regarding FtsK's potential connection to antibiotic resistance and persistent infections:

  • How might FtsK's role in coordinating chromosome segregation and cell division contribute to S. aureus survival during antibiotic treatment?

  • Could targeting FtsK or its interactions disrupt S. aureus persistence within host cells?

  • Does FtsK function differently in antibiotic-resistant strains compared to susceptible strains?

The search results indicate that S. aureus can transition to a dormant-like state with low metabolic activity within macrophages, which has been associated with antibiotic treatment failure and recurrent infections . Understanding whether and how FtsK contributes to this transition could provide insights into developing therapies capable of targeting both high-metabolic and dormant bacteria.

How might FtsK function be exploited for novel antimicrobial development?

FtsK represents a promising target for antimicrobial development for several reasons:

  • It is essential for proper bacterial cell division and chromosome segregation

  • It coordinates multiple critical cellular processes

  • It contains domains and functions distinct from eukaryotic proteins

Given that the cell envelope of S. aureus is vital for resisting turgor pressure and interfacing with the host, and that many strains have evolved resistance to cell-wall-targeting antibiotics , exploring new vulnerabilities in cell envelope biogenesis is valuable. FtsK's role in this process, particularly through its regulation of the peptidoglycan hydrolase Sle1, could provide a novel approach to disrupting bacterial cell division.

Potential strategies could include developing inhibitors that:

  • Disrupt FtsK hexamer assembly

  • Block its translocation activity

  • Interfere with its interactions with other divisome components

  • Prevent its regulation of peptidoglycan hydrolases

What integrative approaches could advance our understanding of FtsK's role in the bacterial cell cycle?

Advancing our understanding of FtsK requires integrative approaches combining:

  • Structural biology techniques to elucidate the complete structure of FtsK, including the poorly characterized N-terminal domain

  • Advanced single-molecule approaches to study real-time dynamics of FtsK during the cell cycle

  • Systems biology approaches to map the entire network of FtsK interactions

  • Computational modeling to integrate diverse datasets and predict FtsK behavior under various conditions

Additionally, using photoconvertible reporter systems to simultaneously track FtsK activity and bacterial metabolic states could provide insights into how FtsK function changes during stress responses or host-pathogen interactions .

These integrative approaches would help address complex questions about FtsK function that cannot be resolved through individual techniques alone, ultimately providing a more comprehensive understanding of this essential bacterial protein and potentially revealing new strategies for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.