Recombinant Staphylococcus aureus Elastin-binding protein ebpS (ebpS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Elastin-Binding Protein EbpS (EbpS)

Staphylococcus aureus Elastin-Binding Protein S (EbpS) is a surface protein that mediates the adhesion of Staphylococcus aureus to elastin, a major protein component of the extracellular matrix . EbpS facilitates the binding of soluble elastin peptides and tropoelastin to S. aureus cells, even though it cannot promote bacterial adherence to immobilized elastin .

Production and Characterization of Recombinant EbpS

Recombinant EbpS can be expressed in Escherichia coli to produce specific antibodies against the N-terminal domain (residues 1-267) and the C-terminal domain (residues 343-486) . In S. aureus, EbpS migrates with an apparent molecular mass of 83 kDa, as determined by Western blotting of lysates from wild-type strains 8325-4 and Newman, and their corresponding ebpS mutants . The protein is found in cytoplasmic membrane fractions purified from protoplasts or lysed cells, unlike the clumping factor ClfA, which is cell-wall-associated .

Functional Aspects of EbpS

EbpS plays a role in the adhesion of S. aureus to elastin, facilitating colonization, invasion, and the formation of metastatic abscesses . The ligand-binding domain of EbpS is located in the N terminus between residues 14-34 . Studies using anti-EbpS1-267 antibodies have confirmed that this region is exposed on the surface of intact cells . Wild-type S. aureus Newman cells bind labeled tropoelastin, while the ebpS mutant binds significantly less (72% reduction) . Furthermore, EbpS expression is associated with increased cell density in liquid culture, indicating a potential role in regulating cell growth .

EbpS and Elastin Binding

EbpS directly mediates the binding of S. aureus to elastin . Polyclonal antibodies raised against recombinant EbpS interact with the native 25-kDa cell surface EbpS and inhibit staphylococcal elastin binding . Recombinant EbpS binds specifically to immobilized elastin and inhibits the binding of S. aureus to elastin . The elastin-binding site in EbpS is located within the first 59 amino acids of the molecule, as truncated forms of recombinant EbpS lacking these residues do not bind to elastin .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
ebpS; SAB1343c; Elastin-binding protein EbpS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-483
Protein Length
Full Length of Mature Protein
Species
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Target Names
ebpS
Target Protein Sequence
SNNFKDDFEKNRQSIDTNSHQDHTEEVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDHQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHETVKDAENNTEHSTVSDKSEAEQSQQPKPYFATGANQANTSK DKHDDVTVKQYKDESKDHHSGKKGAAIGAGTAGVAGAMAASKAKKHSNDAQNKSNSGKAN NSTEDKASQDKSKEHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHDEHD HHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNNADE SKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQANQ NQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQQIV IP
Uniprot No.

Target Background

Function
This protein promotes the binding of soluble elastin peptides and tropoelastin to *Staphylococcus aureus* cells. However, it does not facilitate bacterial adhesion to immobilized elastin and is therefore not classified as a microbial surface component recognizing adhesive matrix molecule (MSCRAMM).
Database Links

KEGG: sab:SAB1343c

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Where is the elastin-binding domain located within the EbpS protein?

The elastin-binding domain of EbpS is located within the N-terminal region of the protein. Specifically, truncation studies and binding assays with recombinant proteins have demonstrated that the elastin binding site is contained within the first 59 amino acids of the molecule . Further refinement through fusion protein studies and antibody probing has narrowed the critical binding region to residues 14-34 . This domain is exposed on the bacterial cell surface, allowing direct interaction with elastin in the host extracellular matrix. This has been confirmed experimentally through binding studies showing wild-type S. aureus Newman cells bound labeled tropoelastin, whereas ebpS mutants exhibited 72% reduced binding capacity .

How is EbpS oriented within the bacterial cell membrane?

EbpS is an integral membrane protein with a specific topological orientation. Experimental evidence using hybrid proteins formed between EbpS at the N-terminus and either alkaline phosphatase or β-galactosidase at the C-terminus (EbpS-PhoA, EbpS-LacZ) has revealed that EbpS contains two membrane-spanning domains (H1 and H3) . The N-terminal residues 1-205, including the elastin-binding domain (residues 14-34), and C-terminal residues 343-486 are exposed on the outer face of the cytoplasmic membrane . This orientation allows the N-terminal elastin-binding domain to be accessible on the bacterial cell surface while the C-terminus, which contains a putative LysM peptidoglycan-binding domain, remains buried within the peptidoglycan layer .

What are the optimal methods for recombinant expression of EbpS?

For recombinant expression of EbpS, E. coli-based systems have proven successful. The methodology involves:

  • Cloning Strategy: The complete ebpS gene should be PCR-amplified using primers that incorporate appropriate restriction sites for directional cloning into expression vectors.

  • Expression System Selection: For full-length EbpS expression, vectors containing strong inducible promoters (such as T7 or tac) are recommended, as demonstrated in successful expression studies .

  • Host Strain Considerations: E. coli strains optimized for membrane protein expression (such as C41/C43 derivatives of BL21) are recommended due to EbpS's integral membrane nature.

  • Expression Conditions: Induction with lower concentrations of IPTG (0.1-0.5 mM) at reduced temperatures (16-25°C) often improves proper folding and reduces inclusion body formation.

  • Domain-Specific Expression: For functional studies of the elastin-binding domain only, expressing the N-terminal fragment (residues 1-59 or 1-267) may yield higher soluble protein and facilitate purification .

When expressing the full-length protein, researchers should anticipate challenges related to its membrane-associated nature and consider detergent extraction methods for downstream applications.

What experimental design approaches are most effective for studying EbpS-elastin interactions?

Studying EbpS-elastin interactions requires robust experimental designs that account for protein localization and binding characteristics. Effective approaches include:

  • Solid-Phase Binding Assays: Immobilizing purified elastin or tropoelastin on surfaces (microplates or membranes) and measuring binding of recombinant EbpS or EbpS-expressing bacteria. This approach has successfully demonstrated specific binding of recombinant EbpS to immobilized elastin .

  • Competition Assays: Pre-incubating EbpS with soluble elastin peptides before testing binding to immobilized elastin can identify specific binding motifs. Recombinant EbpS has been shown to inhibit binding of S. aureus to elastin in competition experiments .

  • Domain Mapping: Testing truncated versions of EbpS (for example, constructs lacking the first 59 amino acids or specific regions within this domain) in binding assays helps precisely map the binding interface .

  • Antibody Inhibition Studies: Using polyclonal antibodies raised against recombinant EbpS domains to inhibit elastin binding provides evidence of binding specificity. This approach confirmed that antibodies against recombinant EbpS interacted with native cell surface EbpS and inhibited staphylococcal elastin binding .

  • Single-Subject Experimental Designs (SSEDs): For in vivo studies of EbpS-mediated infection, properly conducted SSEDs can provide valuable evidence about EbpS function while minimizing variables .

These methodologies should incorporate appropriate controls, including ebpS mutant strains and non-elastin matrix proteins to verify binding specificity.

How can researchers design experiments to distinguish between direct and indirect effects of EbpS on S. aureus virulence?

Distinguishing direct from indirect effects of EbpS on S. aureus virulence requires sophisticated experimental designs:

  • Isogenic Mutant Comparison: Create precise ebpS deletion mutants alongside complemented strains (where ebpS is reintroduced on a plasmid) to isolate the effects of EbpS. This approach should follow proper randomization, replication, and blocking principles of experimental design .

  • Structure-Function Analysis: Generate site-directed mutations within the elastin-binding domain (residues 14-34) that specifically disrupt elastin binding without affecting protein expression or membrane localization. This separates binding function from other potential roles of EbpS.

  • Temporal Expression Analysis: Monitor EbpS expression throughout different growth phases and correlate with virulence phenotypes. This is particularly relevant since EbpS expression has been correlated with the ability of cells to grow to higher density in liquid culture .

  • Multi-factorial Design of Experiments (DoE): Implement factorial experimental designs to simultaneously evaluate multiple factors that might influence EbpS-mediated virulence . For example:

FactorLow LevelHigh Level
EbpS expressionDeletion mutantOverexpression
Growth phaseExponentialStationary
Environmental elastinAbsentPresent
Host cell typeEpithelialEndothelial
  • In vivo Models with Defined Readouts: Use animal models with specific elastin-rich tissues to distinguish between elastin-binding dependent and independent effects. Multiple dependent variables should be measured, including bacterial load, inflammatory markers, and tissue damage.

Employing these approaches while maintaining strict controls for confounding variables will help establish causality in EbpS-mediated virulence.

What are the methodological considerations for studying potential regulatory interactions between EbpS and other virulence factors in S. aureus?

Investigating regulatory interactions between EbpS and other virulence factors requires sophisticated methodological approaches:

  • Transcriptomic Analysis: Compare gene expression profiles between wild-type and ebpS mutant strains using RNA-seq or microarray technology. This can identify genes whose expression is influenced by EbpS, suggesting potential regulatory relationships.

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation using anti-EbpS antibodies followed by mass spectrometry

    • Bacterial two-hybrid systems to screen for direct interactions

    • Förster resonance energy transfer (FRET) between fluorescently labeled EbpS and candidate partners

  • Systematic Genetic Interaction Analysis: Create double mutants lacking both ebpS and candidate interacting genes to identify synthetic phenotypes (where the double mutant exhibits a phenotype not predicted by the individual mutations).

  • Conditional Expression Systems: Develop inducible promoter systems to control EbpS expression and monitor corresponding changes in other virulence factors at both transcriptional and translational levels.

  • Subcellular Co-localization: Using immunofluorescence microscopy or fractionation studies, determine whether EbpS co-localizes with other virulence-associated membrane proteins, supporting potential functional interactions.

These approaches should incorporate evidence-based practice (EBP) principles, ensuring experimental designs meet tier 1 (strong evidence) or tier 2 (moderate evidence) standards where possible .

How can the apparent discrepancy between predicted and observed molecular weight of EbpS be investigated?

The discrepancy between EbpS's predicted molecular mass (23,345 daltons based on amino acid sequence) and its observed migration on SDS-PAGE (apparent molecular mass of 83 kDa) presents an intriguing research question . To investigate this phenomenon, researchers should consider:

  • Post-translational Modification Analysis:

    • Perform mass spectrometry on purified native EbpS to identify potential modifications

    • Treat purified EbpS with deglycosylation enzymes to determine if glycosylation contributes to the size discrepancy

    • Conduct phosphorylation-specific staining or phosphatase treatment to assess phosphorylation status

  • Structural Property Investigation:

    • Analyze hydrophobic regions using various detergents during SDS-PAGE

    • Compare migration patterns under reducing vs. non-reducing conditions

    • Employ urea-based gel systems to fully denature potential structural elements affecting migration

  • Domain Deletion Analysis: Create a series of truncated EbpS variants to identify which regions contribute most significantly to anomalous migration.

  • Comparative Analysis: Express EbpS in different bacterial hosts (S. aureus vs. E. coli) to determine if the migration pattern is influenced by host-specific factors.

  • Biophysical Characterization:

    • Use size-exclusion chromatography to determine native molecular weight

    • Employ analytical ultracentrifugation to assess oligomerization state

    • Perform dynamic light scattering to evaluate hydrodynamic radius

This systematic approach combines biochemical, structural, and genetic techniques to resolve the molecular weight discrepancy, providing insights into EbpS's true structural nature.

What experimental models are most appropriate for studying EbpS-mediated S. aureus interactions with elastin-rich tissues?

Selecting appropriate experimental models for studying EbpS-mediated interactions requires consideration of elastin distribution and physiological relevance:

  • In vitro Tissue Models:

    • Elastin-rich cell matrices using dermal fibroblasts that produce elastin

    • Artificial elastin matrices with controlled composition and architecture

    • Co-culture systems with elastin-producing cells and target host cells

  • Ex vivo Models:

    • Elastin-rich tissue explants (e.g., aortic segments, lung tissue, skin)

    • Perfused organ models maintaining tissue architecture and elastin content

  • In vivo Models:

    • Targeted infection models focusing on elastin-rich tissues (blood vessels, skin, lungs)

    • Age-controlled models (elastin content and crosslinking varies with age)

    • Animal models with manipulated elastin expression

For in vivo studies, researchers should consider single-subject experimental designs (SSEDs) which may be particularly valuable for studying individualized responses to EbpS-expressing bacteria . When implementing these models, researchers should:

  • Define clear dependent variables (bacterial adherence, invasion, host response)

  • Include appropriate controls (ebpS mutants, complemented strains)

  • Account for confounding variables (elastin content variation, inflammatory status)

  • Follow evidence-based practice principles for experimental design

The selection of models should align with specific research questions, from basic binding mechanisms to complex host-pathogen interactions in disease contexts.

How can researchers design experiments to evaluate the therapeutic potential of targeting EbpS-elastin interactions?

Designing experiments to evaluate therapeutic targeting of EbpS-elastin interactions requires a systematic approach:

  • Target Validation Studies:

    • Demonstrate that blocking EbpS-elastin binding reduces virulence in relevant infection models

    • Quantify the contribution of EbpS to pathogenicity relative to other adhesins

    • Identify conditions where EbpS-elastin interactions are most critical for infection

  • Inhibitor Development and Screening:

    • Design a high-throughput screening assay for EbpS-elastin binding inhibitors

    • Test synthetic peptides derived from the N-terminal binding domain (residues 14-34)

    • Screen for small molecules that may disrupt protein-protein interactions

  • Inhibitor Efficacy Testing:

    • Conduct dose-response studies to determine IC50 values for promising inhibitors

    • Evaluate specificity by testing effects on other S. aureus adhesins

    • Assess potential host toxicity and off-target effects

  • In vivo Efficacy Studies:

    • Design of experiments (DoE) approach to optimize dosing regimens

    • Compare preventive vs. therapeutic administration strategies

    • Evaluate combination with conventional antibiotics

  • Resistance Development Assessment:

    • Serial passage experiments to evaluate potential for resistance development

    • Whole genome sequencing to identify compensatory mutations

    • Competition assays between wild-type and potentially resistant strains

Following evidence-based practice frameworks, researchers should ensure that therapeutic targeting studies progress from strong foundational evidence (Tier 1) through well-designed experimental studies before clinical application .

What are the technical challenges in purifying functional recombinant EbpS and how can they be overcome?

Purifying functional recombinant EbpS presents several technical challenges due to its membrane-associated nature. These challenges and their solutions include:

  • Solubility Issues:

    • Challenge: As an integral membrane protein with hydrophobic domains , full-length EbpS tends to aggregate during expression and purification.

    • Solution: Express the N-terminal domain (residues 1-267) containing the elastin-binding site separately, as this region has been successfully expressed as a soluble recombinant protein . Alternatively, optimize detergent conditions (testing CHAPS, DDM, or Triton X-100) for full-length protein extraction.

  • Protein Folding:

    • Challenge: Ensuring proper folding of the elastin-binding domain in recombinant systems.

    • Solution: Employ lower induction temperatures (16-25°C), co-express with molecular chaperones, or use specialized E. coli strains designed for membrane protein expression (C41/C43).

  • Functional Verification:

    • Challenge: Confirming that purified EbpS retains elastin-binding activity.

    • Solution: Develop solid-phase binding assays with immobilized elastin or labeled tropoelastin. Compare binding activity of full-length protein versus the N-terminal domain (residues 1-59) .

  • Purification Strategy:

    • Challenge: Designing an effective purification scheme that maintains protein function.

    • Solution: Implement a two-step purification approach:

      1. Affinity chromatography using tagged constructs (His-tag or GST-fusion)

      2. Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Stability During Storage:

    • Challenge: Preventing degradation during storage.

    • Solution: Stabilize with glycerol (10-20%), test various buffer compositions, and store in small aliquots at -80°C to minimize freeze-thaw cycles.

These methodological approaches should be optimized using Design of Experiments (DoE) principles to efficiently identify optimal conditions while minimizing the number of experiments required .

What methodologies are recommended for studying potential conformational changes in EbpS upon elastin binding?

Investigating conformational changes in EbpS upon elastin binding requires specialized biophysical and structural techniques:

  • Circular Dichroism (CD) Spectroscopy:

    • Compare CD spectra of EbpS alone versus EbpS-elastin complexes to detect changes in secondary structure elements

    • Perform thermal denaturation studies to assess whether elastin binding alters protein stability

  • Fluorescence Spectroscopy:

    • Exploit intrinsic tryptophan fluorescence to monitor local environmental changes upon binding

    • Use site-directed mutagenesis to introduce tryptophan residues at strategic positions

    • Apply fluorescence resonance energy transfer (FRET) between labeled EbpS and elastin derivatives

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map regions of EbpS that show altered solvent accessibility upon elastin binding

    • Identify binding interfaces and potential allosteric sites

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • For smaller constructs (e.g., the N-terminal domain), perform solution NMR to obtain residue-specific information about binding-induced conformational changes

    • Use chemical shift perturbation analyses to map the binding interface

  • Cross-linking Coupled with Mass Spectrometry:

    • Apply chemical cross-linkers of various lengths to "capture" different conformational states

    • Identify cross-linked peptides by mass spectrometry to infer distance constraints

  • Molecular Dynamics Simulations:

    • Complement experimental approaches with in silico modeling of EbpS-elastin interactions

    • Predict potential conformational changes and generate hypotheses for experimental validation

These methodologies should be implemented following systematic experimental design principles, with appropriate controls to distinguish specific binding effects from non-specific interactions or experimental artifacts .

What are promising research directions for understanding the physiological role of EbpS beyond elastin binding?

Beyond its established role in elastin binding, several promising research directions could elucidate additional functions of EbpS:

  • Growth Regulation Studies: Previous research has correlated EbpS expression with the ability of S. aureus to grow to higher densities in liquid culture . Systematic investigations should:

    • Compare growth kinetics and maximum cell densities between wild-type and ebpS mutants under various nutrient conditions

    • Investigate potential roles in nutrient sensing or transport due to its membrane localization

    • Examine whether EbpS influences quorum sensing or biofilm formation

  • Membrane Function Investigation: As an integral membrane protein , EbpS may participate in:

    • Membrane organization or microdomain formation

    • Protein-protein interactions with other membrane components

    • Signal transduction across the cell membrane

  • Host Immune Interaction Studies:

    • Determine if EbpS is recognized by pattern recognition receptors

    • Investigate whether EbpS modulates host inflammatory responses

    • Assess potential interactions with complement or antimicrobial peptides

  • Metabolic Role Examination:

    • Perform metabolomic comparisons between wild-type and ebpS mutants

    • Investigate potential roles in cell wall metabolism given its peptidoglycan-binding LysM domain

    • Examine connections to cellular stress responses

  • Evolutionary Analysis:

    • Compare EbpS structure and function across staphylococcal species

    • Identify co-evolved gene clusters that might suggest functional relationships

    • Analyze selection pressures on different EbpS domains

These research directions should employ evidence-based experimental designs, potentially using single-subject experimental designs (SSEDs) for complex physiological studies and Design of Experiments (DoE) approaches to efficiently explore multiple variables .

How might researchers design experiments to evaluate EbpS as a potential vaccine target against S. aureus infections?

Designing experiments to evaluate EbpS as a vaccine target requires a comprehensive approach:

  • Antigen Formulation and Design:

    • Isolate the N-terminal domain (residues 1-59 or 1-267) containing the elastin-binding site

    • Develop peptide vaccines based on predicted epitopes within the surface-exposed regions

    • Create conjugate vaccines linking EbpS domains to carrier proteins or adjuvants

  • Immunogenicity Assessment:

    • Evaluate antibody responses (titer, isotype, duration) in appropriate animal models

    • Assess T-cell responses to identify potential cellular immunity

    • Determine cross-reactivity against EbpS variants from different S. aureus strains

  • Functional Antibody Evaluation:

    • Test whether vaccine-induced antibodies block EbpS-elastin binding in vitro

    • Evaluate opsonophagocytic activity of anti-EbpS antibodies

    • Assess complement activation by antibody-EbpS complexes

  • Protection Studies:

    • Challenge immunized animals with S. aureus strains in models relevant to human disease

    • Compare protection against wild-type versus ebpS mutant strains

    • Evaluate tissue-specific protection in elastin-rich organs

  • Combination Approach Assessment:

    • Test EbpS antigens in combination with other S. aureus virulence factors

    • Evaluate synergistic protection against multiple adhesion mechanisms

    • Design factorial experiments to identify optimal antigen combinations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.