Recombinant Staphylococcus aureus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Energy-Coupling Factor Transporter Transmembrane Protein EcfT (ecfT)

The Energy-Coupling Factor Transporter Transmembrane Protein EcfT (ecfT) is a critical component of bacterial micronutrient uptake systems. In Staphylococcus aureus, EcfT forms part of the energy-coupling factor (ECF) transporter module (EcfAA’T), which facilitates the import of essential vitamins, ions, and metabolites. Recombinant EcfT refers to the genetically engineered form of this protein, produced in heterologous expression systems like E. coli or yeast for research and therapeutic development .

Molecular Architecture

  • Domain Organization:
    EcfT is a transmembrane protein with six predicted membrane-spanning helices. It serves as a scaffold, interacting with the ATP-binding components (EcfA and EcfA’) to form the ECF module .

    • Sequence: The full-length EcfT protein from S. aureus strain 04-02981 comprises 268 amino acids (UniProt: D3ERJ1), with a conserved N-terminal domain critical for ATPase coupling .

    • Dynamic Conformation: Structural studies of homologous ECF transporters (e.g., LbECF-PanT) reveal that EcfT undergoes conformational changes during substrate transport, enabling energy transduction from ATP hydrolysis to substrate translocation .

Role in Bacterial Physiology

  • Substrate Transport: ECF transporters are ATP-binding cassette (ABC) systems that import micronutrients (e.g., pantothenate, heme) without periplasmic binding proteins. EcfT mediates transmembrane movement of substrates bound to the S component (EcfS) .

  • Phenotypic Impact: Mutations in ecfT are linked to fatty acid auxotrophy in S. aureus small-colony variants (SCVs), impairing growth and persistence in host environments .

Vaccine Development

Recombinant EcfT is investigated as a potential vaccine antigen due to its surface exposure and role in virulence. Studies highlight its inclusion in multi-component vaccines targeting S. aureus infections .

Table 1: Key Research Findings on EcfT in Vaccine Development

Study FocusFindingsSource
ImmunogenicityEcfT elicits Th1 and Th17 immune responses in murine models.
Adjuvant SynergyCpG oligonucleotides enhance EcfT-specific antibody production.
Protection EfficacyVaccination with EcfT reduces bacterial load in pneumonia models.

Antibiotic Resistance and Persistence

  • SCV Formation: Truncated ecfT mutations in clinical SCVs impair fatty acid synthesis, leading to chronic infections resistant to conventional antibiotics .

  • Efflux Pump Interactions: ECF transporters may synergize with multidrug efflux systems (e.g., MFS, ABC transporters) to enhance antibiotic tolerance .

Future Directions and Challenges

  • Structural Biology: Cryo-EM studies are needed to resolve EcfT’s role in substrate translocation and ATPase coupling .

  • Therapeutic Targeting: Inhibitors of ECF transporters could disrupt nutrient uptake in S. aureus, potentiating existing antibiotics .

  • Vaccine Optimization: Combining EcfT with other antigens (e.g., α-toxin, capsular polysaccharides) may improve vaccine efficacy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ecfT; SA2981_2158; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Staphylococcus aureus (strain 04-02981)
Target Names
ecfT
Target Protein Sequence
MKNKLIIGRYLPINSFVHHLDPRAKLMFVFLFIILIFFCHSPLTYLWVFALILFIMRLAK IQLWFLIKGLTPIFFFLIFTLMMHIFLTKGGYVLVEWHGITIETNGILEGLYISLRLIGI VMIATIMTLSTSPIDLTDAFERLLAPLKMFKLPVHQLSMIMSIALRFIPTLMDELDKIIL AQKSRGSEISSGNIATRIKSFIPLLVPLFISAFQRAEELAVAMEVRGYDANVKRTSYRQL KWQLRDTISLTMIIPIAIILFVLKYSGV
Uniprot No.

Target Background

Function
Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy necessary to transport a variety of substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Energy-coupling factor (ECF) transporter system and what role does EcfT play?

Energy-coupling factor (ECF) transporters constitute a specialized subgroup of ATP-binding cassette (ABC) transporters that facilitate micronutrient uptake from the environment . These transporters consist of multiple components working in concert:

  • S component (EcfS): A substrate-binding protein specific to particular micronutrients

  • T component (EcfT): A transmembrane protein serving as a scaffold

  • A and A' components (EcfA/A'): ATP-binding proteins that provide energy through ATP hydrolysis

EcfT functions as a critical scaffold within this complex, mediating interactions between the energy-providing components (EcfA/A') and the substrate-specific component (EcfS). It contains essential coupling helices (CH2 and CH3) that facilitate the transmission of conformational changes from the ATP-binding domains to the substrate-binding protein, enabling the transport process . Research on the pantothenate ECF transporter from Lactobacillus brevis indicates that EcfT has a dynamic structure that supports its role as a mediator between different components of the transporter complex .

How do ECF transporters differ from other ATP-binding cassette (ABC) transporters?

ECF transporters possess several distinctive features that set them apart from conventional ABC transporters:

  • Component organization: While typical ABC transporters consist of transmembrane domains fused to nucleotide-binding domains, ECF transporters have a unique architecture with separate S components for substrate specificity .

  • S-component sharing: In Group II ECF transporters, multiple substrate-specific S components (EcfS) can share a single ECF module (consisting of EcfT/A/A'), allowing for efficient transport of different micronutrients using shared molecular machinery .

  • Conformational dynamics: ECF transporters undergo significant structural rearrangements during the transport cycle, with the EcfT component showing particularly dynamic behavior that enables it to interact with different S components .

  • Substrate specificity: ECF transporters are specialized for micronutrient uptake, including vitamins and trace elements, rather than the broader substrate range of many other ABC transporters.

What is the basic structure of the ECF transporter complex?

The ECF transporter complex exhibits a modular structure consisting of four main components:

  • S component (EcfS): A substrate-binding protein with six transmembrane helices that recognizes and binds specific micronutrients. Different S components exist for different substrates (e.g., PanT for pantothenate, FolT for folate) .

  • T component (EcfT): A transmembrane protein containing important coupling helices (CH2 and CH3) that mediate interactions between the EcfA/A' and EcfS components .

  • A and A' components (EcfA/A'): ATP-binding cassette proteins that provide energy for the transport process through ATP hydrolysis .

The structure of the pantothenate ECF transporter from Lactobacillus brevis (LbECF-PanT) reveals that the coupling helices CH2 and CH3 of EcfT interact with transmembrane helices SM1, SM2, and SM6 of the S component, enabling the transmission of conformational changes during the transport cycle .

What experimental approaches are most effective for expressing recombinant S. aureus EcfT protein?

Successful expression of recombinant S. aureus EcfT requires careful consideration of multiple factors. The following approaches have proven effective for membrane proteins and may be applicable to EcfT:

Table 1: Comparison of Expression Systems for Recombinant EcfT Production

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)Well-established, high yields, economicalMay form inclusion bodies with membrane proteinsLower temperature (16-20°C), reduced inducer concentration, codon optimization
E. coli C41/C43(DE3)Specifically designed for membrane proteinsLower yields than standard strainsOptimize translation initiation sites , use specialized media
Cell-free systemsAvoids toxicity issues, direct incorporation into membranesExpensive, limited scaleAdd detergents or lipids during synthesis
Lactococcus lactisGram-positive system, better for some membrane proteinsLower yields, more complex manipulationNICE expression system, optimize codon usage
Bacillus subtilisRelated to S. aureus, native-like membraneLower yields, potential proteolysisProtease-deficient strains, optimized signal sequences

Optimization of the translation initiation site is particularly important, as accessibility of these sites significantly impacts expression success . Tools such as TIsigner can be used to modify the first nine codons of mRNAs with synonymous substitutions to enhance translation initiation . Additionally, co-expression with other components of the ECF transporter complex (EcfA/A') may improve stability and proper folding of EcfT.

How does the conformational dynamics of EcfT affect its function in ECF transporters?

The conformational dynamics of EcfT play a crucial role in the function of ECF transporters:

  • Scaffold flexibility: Research on the pantothenate ECF transporter from Lactobacillus brevis (LbECF-PanT) demonstrates that EcfT has a conformationally dynamic structure that enables it to function as a scaffold for complex formation with various EcfS proteins .

  • Conformational transmission: The coupling helices (CH2 and CH3) of EcfT mediate interactions with both the ATP-binding domains (EcfA/A') and the substrate-binding protein (EcfS), enabling the transmission of conformational changes during the transport cycle .

  • S-component interaction: In Group II ECF transporters, where several EcfS proteins share one ECF module, the dynamic structure of EcfT allows it to interact with different S components despite sequence dissimilarities among these components .

  • Transport mechanism: CH2 of EcfT interacts mainly with transmembrane helix SM1 of EcfS via hydrophobic interactions, which may modulate the sliding movement of EcfS during transport. CH3 binds to a hydrophobic surface groove formed by SM1, SM2, and SM6, transmitting conformational changes from EcfA/A' to EcfS .

These dynamic properties are essential for the proper functioning of ECF transporters and represent a key area for research to understand the molecular mechanisms of micronutrient transport.

What are the critical residues in S. aureus EcfT that affect transporter activity?

While specific information about critical residues in S. aureus EcfT is limited in the provided search results, studies of the pantothenate ECF transporter from Lactobacillus brevis (LbECF-PanT) identify several conserved residues that are crucial for transporter activity:

Table 2: Critical Residues in EcfT Based on Studies of LbECF-PanT

ResidueLocationFunctionEffect of MutationConservation
Arg185XRX motif 1Forms salt bridge with Asp106 of EcfAR185E abolishes transporter activityStrictly conserved across ECF transporters
Arg226XRX motif 2Forms salt bridge with Asp102 of EcfA'R226E abolishes transporter activityStrictly conserved across ECF transporters
Flanking residues (A184, G186, A225, G227)Adjacent to XRX motifsStructural context for conserved Arg residuesA184V, G186A, A225V, G227A have minor effects on activityLess conserved than Arg residues

These residues are strictly conserved among all ECF transporters, suggesting that they play critical roles in the transport mechanism . Mutation of any of these residues to an oppositely charged residue (e.g., R185E, R226E) abolishes transporter activity . Since these residues are conserved across ECF transporters, it is likely that homologous residues in S. aureus EcfT perform similar functions in mediating interactions with EcfA/A' and transmitting conformational changes during the transport cycle.

How do mutations in the conserved regions of EcfT affect transporter complex formation and function?

Research on the pantothenate ECF transporter from Lactobacillus brevis provides insights into how mutations in conserved regions of EcfT affect transporter complex formation and function:

  • Effect on transporter activity: Mutations of conserved residues Arg185 and Arg226 in EcfT to oppositely charged residues (R185E and R226E) abolish transporter activity, as do mutations of the interacting residues Asp106 of EcfA and Asp102 of EcfA' to oppositely charged residues (D106R and D102R) .

  • Effect on complex formation: Interestingly, most of these mutations (except D102R) have only minor effects on the formation of the transporter complex in vitro . This suggests that these conserved residues exert their functions primarily through the transmission of conformational changes between components rather than by maintaining complex stability.

  • Functional significance: The conserved arginine residues of EcfT (Arg185 and Arg226) are involved in mediating intramolecular signaling during the transport process . They form salt bridges with conserved aspartate residues in EcfA/A', anchoring the coupling helices to the ATP-binding domains and enabling the transmission of conformational changes triggered by ATP binding and hydrolysis.

  • Flanking residues: Mutations of residues flanking the conserved arginine residues (A184V, G186A, A225V, G227A) have relatively minor effects on transporter activity , indicating that the specific interactions formed by the conserved arginine residues are more critical than the local structural context.

These findings highlight the importance of specific conserved residues in EcfT for transporter function, particularly for the transmission of conformational changes during the transport cycle, rather than for maintaining the structural integrity of the complex.

What are the best expression systems for producing functional recombinant S. aureus EcfT?

The choice of expression system is critical for obtaining functional recombinant S. aureus EcfT. Based on general principles for membrane protein expression and information from the search results, the following approaches may be effective:

  • E. coli expression systems:

    • BL21(DE3) and derivatives: These strains lack certain proteases and are commonly used for recombinant protein expression .

    • C41(DE3) and C43(DE3): These strains are specifically designed for membrane protein expression and may provide advantages for EcfT production.

    • Tuner strains: These allow precise control of protein expression levels, which can be crucial for membrane proteins that may be toxic when overexpressed.

  • Cell-free expression systems:

    • These systems can be advantageous for membrane proteins as they allow direct incorporation into artificial membranes or nanodiscs.

    • They bypass potential toxicity issues associated with overexpression of membrane proteins in living cells.

  • Alternative host systems:

    • Gram-positive expression hosts (like Bacillus subtilis): Being more closely related to S. aureus, these may provide a more native-like membrane environment for proper folding of EcfT.

    • Lactococcus lactis: This system has been successful for expression of membrane proteins from Gram-positive bacteria.

  • Expression optimization strategies:

    • Codon optimization: Adapting the coding sequence to the codon usage bias of the expression host can improve expression levels .

    • Translation initiation optimization: Ensuring the accessibility of translation initiation sites significantly impacts expression success .

    • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often improve the expression of functional membrane proteins.

For any chosen system, it's crucial to optimize the accessibility of translation initiation sites, as this has been shown to significantly impact the success of recombinant protein expression .

What purification methods yield the highest purity and activity of recombinant EcfT protein?

Purification of membrane proteins like EcfT presents specific challenges. Based on general principles for membrane protein purification and information from studies of similar proteins, the following methods may be effective:

  • Affinity chromatography:

    • Histidine-tag purification: Addition of a His-tag to EcfT allows purification using immobilized metal affinity chromatography (IMAC). This approach was used successfully for purification of recombinant exfoliative toxins and EcfT from other bacterial species .

    • Other affinity tags: Strep-tag, FLAG-tag, or MBP-fusion can provide alternative purification options with potentially higher specificity.

  • Membrane extraction and solubilization:

    • Detergent screening: Different detergents (DDM, LMNG, CHAPS, etc.) should be screened to identify those that efficiently extract EcfT while maintaining its native conformation and activity.

    • Nanodiscs or amphipols: These provide a more native-like membrane environment and may better preserve the functional state of EcfT.

  • Chromatographic methods:

    • Size exclusion chromatography (SEC): This can separate properly folded monomeric or oligomeric EcfT from aggregates or improperly folded species.

    • Ion exchange chromatography: This can provide additional purification based on the charge properties of EcfT.

  • Co-purification strategies:

    • Co-expression and co-purification with other components of the ECF transporter complex (EcfA/A') may enhance stability and proper folding of EcfT.

    • This approach has been successful for structural studies of ECF transporters .

It's important to note that the specific purification protocol should be optimized for each recombinant construct and expression system, with careful attention to maintaining the native conformation and activity of EcfT throughout the purification process.

How can researchers assess the functional activity of recombinant EcfT in vitro?

Assessing the functional activity of recombinant EcfT presents challenges because EcfT functions as part of a multi-component transporter complex. Several approaches can be used:

  • Reconstitution assays:

    • Reconstitution of purified EcfT with other components of the ECF transporter (EcfA, EcfA', and EcfS) in liposomes or nanodiscs.

    • Measurement of substrate transport using radiolabeled substrates or fluorescent substrate analogs.

  • ATP hydrolysis assays:

    • Although EcfT itself does not hydrolyze ATP, its interaction with EcfA/A' can be assessed by measuring ATP hydrolysis rates of the reconstituted complex.

    • Changes in ATPase activity upon addition of substrate and EcfS can provide insights into the functional coupling between components.

  • Binding assays:

    • Surface plasmon resonance (SPR) to measure binding of EcfT to other components of the ECF transporter complex.

    • Isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamic parameters.

  • Conformational change assays:

    • Fluorescence-based assays using site-specific fluorescent labels to detect conformational changes in EcfT upon interaction with other components or during the transport cycle.

    • EPR spectroscopy with spin-labeled EcfT to monitor distances between specific residues during conformational changes.

  • Mutational analysis:

    • Systematic mutation of conserved residues in EcfT (such as Arg185 and Arg226 identified in LbECF-PanT ) followed by functional assays.

    • Complementation assays in EcfT-deficient bacterial strains to assess the ability of mutant EcfT proteins to restore transporter function.

Importantly, experimental design should include appropriate controls and consider the principles of design of experiments (DOE) to ensure robust and reproducible results.

How can researchers interpret contradictory data from EcfT mutagenesis studies?

Interpreting contradictory data from mutagenesis studies is a common challenge in protein research. For EcfT, the following approaches may help resolve discrepancies:

  • Consider functional context:

    • EcfT functions as part of a multi-component complex, so mutations may have different effects depending on which aspect of function is being assayed.

    • For example, mutations in the conserved arginine residues of LbEcfT (Arg185 and Arg226) abolish transporter activity but have minimal effects on complex formation , indicating that these residues are more critical for conformational transmission than for structural integrity.

  • Examine experimental conditions:

    • Different assay conditions (detergents, lipid composition, temperature, pH) may affect the impact of mutations.

    • In vitro assays may not fully recapitulate the native membrane environment, potentially leading to discrepancies with in vivo results.

  • Consider protein dynamics:

    • EcfT has been shown to be conformationally dynamic , so mutations may have different effects depending on which conformational state is being examined.

    • Time-resolved studies may be necessary to capture the effects of mutations on dynamic processes.

  • Analyze position-specific effects:

    • Mutations at the same position to different amino acids may have different effects depending on the physicochemical properties of the substituted residue.

    • For example, charge-reversal mutations (R185E, R226E) in LbEcfT abolish transporter activity, while more conservative mutations might have milder effects .

  • Integrate multiple approaches:

    • Combining biochemical, biophysical, and structural approaches can provide a more complete picture of mutation effects.

    • For example, complementing activity assays with structural studies can clarify whether mutations affect function through conformational changes or disruption of specific interactions.

The design of experiments (DOE) approach can systematically explore factors that might influence the outcome of mutagenesis studies, helping to identify sources of variability and resolve contradictions. This approach involves carefully planning experiments to efficiently explore multiple variables simultaneously, reducing the number of experiments needed while maximizing the information obtained.

What statistical approaches are recommended for analyzing EcfT-substrate interaction data?

  • For binding affinity determination:

    • Nonlinear regression for fitting binding curves (e.g., to determine Kd values).

    • Statistical comparison of binding parameters (Kd, Bmax) using t-tests or ANOVA for comparing multiple conditions.

    • Bootstrap or jackknife resampling to estimate confidence intervals for binding parameters.

  • For kinetic analyses:

    • Global fitting of time-course data to appropriate kinetic models.

    • Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) for model selection when comparing different kinetic mechanisms.

    • Residual analysis to assess the goodness-of-fit and identify systematic deviations from the model.

  • For mutational analyses:

    • Factorial design approaches to systematically explore the effects of multiple mutations and their interactions .

    • Multiple linear regression to identify contributions of specific residues to binding energy.

    • Cluster analysis to identify functionally related residues based on similar mutation effects.

  • For high-throughput screening data:

    • Robust Z-score or B-score calculations to normalize data and control for plate effects.

    • False discovery rate (FDR) control for multiple hypothesis testing.

    • Principal component analysis (PCA) or t-SNE for dimensionality reduction and visualization of complex datasets.

The design of experiments (DOE) methodology is particularly valuable for optimizing experimental conditions and analyzing complex datasets with multiple variables. This approach can help identify interactions between different factors affecting EcfT function and provide a more comprehensive understanding of structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.