Recombinant Staphylococcus aureus Enterotoxin type I (SEI)

Shipped with Ice Packs
In Stock

Description

Biological Activities of SEI

SEI functions as a superantigen, causing unregulated T-cell activation and cytokine release. Key activities include:

Superantigenic Properties

  • Binds to major histocompatibility complex (MHC) class II molecules and T-cell receptor (TCR) Vβ regions, stimulating ~20% of T cells .

  • Induces interleukin-2 (IL-2) and interferon-γ (IFN-γ) production, contributing to cytokine storms .

Emetic Effects

  • Primate Studies: Nasogastric administration of SEI to rhesus monkeys triggers vomiting, confirming its role in food poisoning .

  • Heat and pH Stability: Resists denaturation under extreme conditions (e.g., low pH, high heat), enabling persistence in contaminated foods .

Phylogenetic Relationships

SEI clusters with SEA, SEE, and SED (26–28% amino acid identity) but diverges from SEG, SEB, and SEC1 . This divergence impacts its immune evasion strategies and pathogenic potential.

Research Applications of Recombinant SEI

Recombinant SEI is critical for studying pathogenicity, developing diagnostics, and advancing therapeutic strategies.

Vaccine Development

  • Target: Neutralizing SEI’s superantigenic activity to prevent T-cell hyperactivation.

  • Approach: Recombinant SEI proteins (e.g., His-tagged variants) are used to generate antibodies for vaccine candidates .

Diagnostic Assays

  • Immunoassays: Monoclonal antibodies (e.g., SEI44/SEI32 pairs) enable specific detection of SEI in food or clinical samples .

  • PCR and RT-PCR: Detect sei gene presence or transcription in S. aureus isolates, though production levels often correlate poorly with gene presence .

Pathogenicity Studies

  • Genomic Correlation: vSaβ types (e.g., XI, XIX) predict SEI production levels; strains with truncated sei genes fail to produce detectable toxin .

  • Co-Infection Dynamics: SEI coexists with seg in some S. aureus strains, complicating outbreak tracing .

Detection and Quantification Challenges

SEI detection remains challenging due to its low in vitro production and cross-reactivity with other enterotoxins.

MethodAdvantagesLimitations
Sandwich ELISAHigh specificity for SEIRequires monoclonal antibody pairs (e.g., SEI44/SEI32)
Multiplex PCRRapidly identifies sei gene presenceDoes not confirm toxin production
Recombinant Protein AssaysValidates functional SEI activityLimited to research settings

Notably, ~60% of sei-harboring strains fail to produce detectable SEI, highlighting the need for advanced detection tools .

Epidemiological Significance

SEI is prevalent in S. aureus isolates but underrecognized in clinical settings. Key findings include:

  • Co-Occurrence: sei often coexists with seg in foodborne or animal-derived strains .

  • Disease Association: SEI contributes to food poisoning and secondary infections (e.g., pneumonia) but is rarely linked to toxic shock syndrome .

  • Genomic Predictors: vSaβ types and clonal complexes (CC) correlate with SEI production levels, aiding outbreak tracing .

Product Specs

Buffer
For liquid delivery, the default storage buffer is Tris/PBS-based, containing 5%-50% glycerol.
Please note: If you have specific requirements regarding glycerol content, kindly indicate them in your order remarks.
If the delivery form is lyophilized powder, the buffer used prior to lyophilization is Tris/PBS-based, containing 6% Trehalose.

Form
The delivery format can be either Liquid or Lyophilized powder.
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the delivery format, please mention them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-242aa
Mol. Weight
47.9 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Target Names
SEI
Target Protein Sequence
MKKFKYSFILVFILLFNIKDLTYAQGDIGVGNLRNFYTKHDYIDLKGVTDKNLPIANQLEFSTGTNDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKIATNKKLVTAQEIDVKLRRYLQEEYNIYGHNNTGKGKEYGYKSKFYSGFNNGKVLFHLNNEKSFSYDLFYTGDGLPVSFLKIYEDNKIIESEKFHLDVEISYVDSN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Q&A

What is the molecular structure and genetic organization of SEI?

SEI is encoded by the sei gene, which consists of 729 nucleotides encoding a precursor protein of 242 amino acids . The protein contains a typical bacterial signal sequence that is cleaved to form a mature toxin of 218 amino acids with a molecular weight of 24,928 Da . The sei gene is located within the enterotoxin gene cluster (egc), which is part of the S. aureus genomic island vSaβ . This genomic location is significant because the egc cluster contains several other enterotoxin genes including seg, sem, sen, seo, and seu, which together represent an important virulence determinant in S. aureus . Phylogenetic analysis has shown that SEI shares highest amino acid sequence identity (26-28%) with other staphylococcal enterotoxins including SEA, SEE, and SED . This moderate sequence homology suggests distinctive functional properties of SEI compared to other enterotoxins in the same family.

What detection methods are available for SEI in research settings?

Detection of SEI primarily relies on immunological methods such as enzyme-linked immunosorbent assays (ELISAs). Researchers have developed polyclonal antibody-based sandwich ELISA systems for SEI detection with sensitivity reaching approximately 0.125 ng/mL . These assay systems typically use purified recombinant or histidine-tagged SEI (HisSEI) to generate specific polyclonal antisera . Immunoblot analysis using anti-SEI antisera has revealed that unlike SEG (which shares some epitopes with SEC1), SEI does not demonstrate significant cross-reactivity with other staphylococcal enterotoxins, making it amenable to specific detection . The detection of SEI can also be approached at the genetic level through PCR amplification of the sei gene, though this approach indicates the potential for SEI production rather than confirming actual protein expression . It's important to note that while detection methods for classical enterotoxins (SEA to SEE) are well established, methods for more recently discovered enterotoxins like SEI are less widely available, which presents challenges for investigating their role in food poisoning outbreaks .

How can researchers predict SEI production based on genomic analysis of S. aureus strains?

Recent research has demonstrated promising approaches to predict in vitro production of SEI based on whole-genome sequencing data . S. aureus strains can be allocated to different vSaβ types through bioinformatic analysis, with each type being associated with a specific clonal complex (CC) . Importantly, both the vSaβ type and CC correlate with the amount of SEI produced by a strain . This genomic prediction approach involves several methodological steps:

  • Whole genome sequencing of S. aureus isolates

  • Phylogenetic analysis using core genome data

  • Identification of vSaβ genomic island type

  • Determination of clonal complex (CC) through multilocus sequence typing (MLST) or whole genome analysis

  • Correlation of genomic features with in vitro SEI production measured by ELISA

This predictive approach represents a significant advancement in understanding SEI production potential without requiring direct protein measurement, which can be technically challenging . Additionally, genome analysis can help determine the likely source of an outbreak strain (human or cattle-derived), providing valuable epidemiological insights . Researchers should note that while this predictive approach shows promise, validation with in vitro protein expression testing remains important for conclusive results.

What are the immunological mechanisms of SEI-mediated T-cell activation?

SEI functions as a superantigen that induces profound T-cell proliferation through unconventional mechanisms that bypass normal antigen processing pathways. The methodological approach to studying SEI's superantigenic properties includes several key experimental procedures:

  • Isolation of peripheral blood mononuclear cells (PBMCs) from human donors

  • Exposure of PBMCs to purified recombinant SEI at various concentrations (typically ranging from 1 ng/mL to 10 fg/mL)

  • Measurement of T-cell proliferation using tritiated thymidine incorporation or CFSE dilution assays

  • Quantification of cytokine production (particularly IL-2 and IFN-γ) by ELISA

  • Analysis of T-cell receptor Vβ usage patterns through flow cytometry to determine SEI's T-cell specificity

Research has demonstrated that SEI and SElN continue to induce T-cell proliferation at concentrations as low as 0.1 pg/mL, whereas SEB shows decreased induction at concentrations below 1 pg/mL . This exceptional potency highlights SEI's efficiency as a superantigen. Furthermore, studies examining the potential of supernatants from egc-positive strains have shown that they can induce proliferation up to a dilution stage of 10^-4, demonstrating the biological activity of naturally produced SEI . For researchers investigating the immunological mechanisms of SEI, it is critical to include appropriate controls and to verify the purity of recombinant proteins to avoid confounding results from contaminating bacterial components.

How does the expression and regulation of SEI differ between clinical and food-associated S. aureus strains?

The expression of SEI shows notable variation between S. aureus strains from different sources, which has significant implications for food safety and clinical microbiology research. Methodologically, this question can be approached through:

  • Collection and characterization of diverse S. aureus isolates from food, human, and animal sources

  • Whole genome sequencing and typing of strains (CC determination)

  • Quantitative analysis of sei gene expression using RT-qPCR under different growth conditions

  • Measurement of SEI protein production using validated ELISA systems

  • Correlation of expression profiles with genomic features and strain origin

Research has revealed that the vSaβ type and clonal complex (CC) of a strain are associated with its origin (human or cattle-derived) . This genomic association extends to the amount of SEI produced, suggesting evolutionary adaptation of expression levels depending on the ecological niche . Researchers investigating SEI expression should consider controlling for growth phase, as staphylococcal enterotoxins are typically synthesized throughout the logarithmic growth phase or during the transition from exponential to stationary phase . Additionally, environmental factors such as pH, temperature, and nutrient availability can significantly impact enterotoxin expression and should be carefully controlled in comparative studies.

What are the recommended protocols for recombinant SEI production and purification?

Recombinant production of SEI is essential for many research applications, including antibody generation, functional studies, and structural analysis. A robust methodology for SEI production includes:

  • Amplification of the sei gene (minus signal sequence) from S. aureus genomic DNA

  • Cloning into an appropriate expression vector (commonly pET or pQE systems)

  • Expression in E. coli under optimized conditions (typically IPTG induction)

  • Cell lysis and initial clarification of lysate

  • Affinity purification (commonly using histidine tags and Ni-NTA chromatography)

  • Secondary purification steps (ion exchange or size exclusion chromatography)

  • Validation of purity by SDS-PAGE and Western blotting

  • Functional validation through T-cell proliferation assays

For biological activity studies, it's critical to remove or cleave affinity tags where possible, as they may interfere with protein function. Additionally, endotoxin removal is essential when preparing SEI for immunological studies to prevent non-specific immune activation by contaminating lipopolysaccharides from E. coli. Quality control should include mass spectrometry confirmation of protein identity and testing for emetic activity in appropriate animal models if claims about enterotoxin activity are being made .

What approaches can be used to study SEI in the context of food safety?

Investigating SEI in food safety contexts requires specialized methodologies that address the unique challenges of food matrices. Key approaches include:

  • Development of extraction protocols for SEI from various food matrices

  • Optimization of sample preparation to minimize matrix interference in detection assays

  • Implementation of sensitive detection methods (sandwich ELISA with a detection limit of ~0.125 ng/mL)

  • Genetic screening of food isolates for sei gene presence

  • Challenge studies to determine SEI production in food under various storage conditions

  • Development of multiplex detection systems that can simultaneously detect multiple enterotoxins

A critical methodological consideration is the remarkable heat and acid resistance of staphylococcal enterotoxins, including SEI . This means that even properly heat-treated foods may still contain active toxin if S. aureus was allowed to grow and produce enterotoxins before processing. Researchers should design studies that account for this stability, particularly when investigating food poisoning outbreaks where the causative agent may no longer be viable but toxins remain. Additionally, because SEI is produced at relatively low levels compared to classical enterotoxins, concentration steps may be necessary for reliable detection in food samples.

How can neutralizing antibodies against SEI be developed and evaluated?

The development of neutralizing antibodies against SEI is valuable for both research applications and potential therapeutic interventions. A systematic approach includes:

  • Immunization of animals (commonly rabbits) with purified recombinant SEI

  • Characterization of antisera titer by ELISA (dilutions sufficient to give valid detection signals)

  • Evaluation of specificity through cross-reactivity testing with other enterotoxins

  • Assessment of neutralizing activity in T-cell proliferation assays

  • Purification of IgG fraction from high-titer antisera

  • Potential development of monoclonal antibodies for improved specificity

  • In vivo validation of protection in appropriate animal models

Research has shown that SEI is highly immunogenic, with rabbit antisera reaching high titers (>2.5 × 10^5–10^6) after four immunizations . These antisera can be effectively used in sandwich ELISA systems for SEI detection and potentially for neutralization of SEI activity in both in vitro and in vivo models. For therapeutic applications, humanization of promising monoclonal antibodies may be considered to reduce immunogenicity in potential clinical applications.

What are the critical gaps in our understanding of SEI's role in food poisoning outbreaks?

Despite advances in characterizing SEI at the molecular and immunological levels, significant knowledge gaps remain regarding its epidemiological importance in food poisoning. Key methodological challenges include:

  • Limited availability of standardized detection methods for SEI in clinical and food samples

  • Difficulty in attributing emetic effects specifically to SEI in polymicrobial or multi-toxin scenarios

  • Lack of comprehensive surveillance data on SEI prevalence in food-associated S. aureus strains

  • Incomplete understanding of the dose-response relationship for SEI in humans

  • Limited knowledge of interactions between SEI and other enterotoxins in food poisoning contexts

These challenges highlight the need for improved diagnostic approaches and more comprehensive epidemiological studies. Researchers addressing these gaps should consider multiplex detection systems that can simultaneously identify multiple enterotoxins, and case-control studies that correlate the presence of SEI with clinical outcomes in food poisoning events. Additionally, development of animal models that more closely mimic human responses to orally ingested enterotoxins would provide valuable tools for studying SEI's specific contributions to foodborne illness .

How might SEI contribute to non-foodborne S. aureus infections and immune modulation?

Beyond its role as an enterotoxin, SEI's superantigenic properties suggest potential contributions to other aspects of S. aureus pathogenesis. Methodological approaches to investigate these broader roles include:

  • Analysis of sei gene presence and expression in diverse clinical isolates

  • In vitro models of host-pathogen interaction incorporating SEI exposure

  • Ex vivo tissue culture systems to assess tissue-specific effects

  • Animal models of S. aureus infection with wild-type and sei-deficient strains

  • Immune profiling to determine SEI's impact on host response during infection

Given SEI's potent ability to stimulate T-cell proliferation at very low concentrations (effective down to 0.1 pg/mL), even minimal expression during infection could potentially contribute to immunomodulation . This might include both immunostimulatory effects that drive inflammation and paradoxical immunosuppressive effects through T-cell exhaustion or anergy following superantigen exposure. Researchers exploring these aspects should carefully consider dosage and timing in experimental designs, as effects may be concentration-dependent and evolve over the course of infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.