Recombinant Staphylococcus aureus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Glycerol-3-phosphate Acyltransferase (PlsY)

Recombinant Staphylococcus aureus glycerol-3-phosphate acyltransferase (PlsY) is a bacterial membrane protein produced via recombinant DNA technology for biochemical and pharmacological studies. PlsY catalyzes the committed step in bacterial phospholipid biosynthesis by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (lysoPA) . This enzyme is essential in Gram-positive pathogens like S. aureus and represents a promising antimicrobial target due to its absence in eukaryotes . Recombinant PlsY is typically expressed in Escherichia coli with affinity tags (e.g., His-tag) for purification .

Enzymatic Activity and Assay Development

PlsY activity is measured using a fluorescence-coupled assay detecting inorganic phosphate (Pi) release from acylP :

  • Key steps:

    1. Lag phase: ~2 minutes for G3P diffusion into lipid cubic phase (LCP).

    2. Linear phase: LysoPA production monitored via Pi-biosensor fluorescence .

    3. Validation by thin-layer chromatography (TLC) confirming lysoPA formation .

Kinetic Parameters

  • KmK_m for G3P: 0.2–0.5 mM (wild-type) .

  • Activity loss in Gly105P/V106P mutants: >95% due to disrupted phosphate hole .

Role in Bacterial Pathogenesis and Antimicrobial Targeting

PlsY is indispensable in S. aureus phospholipid biosynthesis. Key findings include:

  • Essentiality: Dual deletion of plsX (acylP synthase) and plsY is lethal in E. coli .

  • Virulence Link: Disruption of PlsY impairs α-hemolysin secretion and virulence gene expression .

  • Inhibitors: Acyl-sulfamates block PlsY activity, showing bactericidal effects in S. aureus .

Applications in Research

  1. Drug Discovery: High-throughput screening of PlsY inhibitors using structural data .

  2. Mechanistic Studies: Elucidating acyltransferase mechanisms in Gram-positive pathogens .

  3. Antimicrobial Development: Targeting PlsY to combat multidrug-resistant S. aureus strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SAB1210c; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Target Names
plsY
Target Protein Sequence
MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLD IFKGFITVFFPLWLPVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGV VLGVNPILLLILAIIFFIILKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIIL IIRHRSNIARIFRGEEPKIKWM
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: sab:SAB1210c

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Staphylococcus aureus PlsY in bacterial pathogenesis?

Staphylococcus aureus PlsY catalyzes the committed step in bacterial phospholipid biosynthesis by acylating glycerol-3-phosphate (G3P) to form lysophosphatidic acid. This enzyme represents a unique class of acyltransferase that exists exclusively and ubiquitously in bacteria, being the sole glycerol-3-phosphate acyltransferase (GPAT) in most Gram-positive bacteria .

The significance of PlsY extends beyond its metabolic role, as S. aureus is a prominent human pathogen responsible for skin and soft tissue abscesses. The pathogen requires specific virulence factors to establish infection and abscess formation, and the phospholipid membrane synthesized through pathways involving PlsY is critical for bacterial survival and virulence . Within abscess environments, S. aureus organizes as a staphylococcal abscess community (SAC) at the center of lesions, shielded from host immune cells by a pseudocapsule comprised of fibrin deposits, which facilitates bacterial survival, replication, and eventual dissemination .

What structural features distinguish PlsY from other acyltransferases?

PlsY represents a distinctive class of acyltransferases with several unique structural characteristics that differentiate it from conventional acyltransferases:

Structural FeaturePlsY CharacteristicsConventional Acyltransferases
Transmembrane organizationSeven-transmembrane helix foldVariable; often soluble or peripheral membrane proteins
Catalytic motifsNo known acyltransferase motifsContain conserved acyltransferase motifs
Acyl donorUses acyl-phosphateUse acyl-CoA or acyl-carrier protein
HomologyNo eukaryotic homologsOften have eukaryotic homologs (e.g., PlsB)
Active siteRelatively inflexibleOften demonstrate conformational flexibility

The crystal structure of PlsY at 1.48 Å resolution, determined using crystals grown in an activity-supporting lipid bilayer environment, has revealed these distinctive features. The enzyme's unique structural elements likely contribute to its substrate specificity and catalytic mechanism, which appears to involve "substrate-assisted catalysis" that does not require a proteinaceous catalytic base from the enzyme .

How does the catalytic mechanism of PlsY differ from other acyltransferases?

PlsY employs a unique "substrate-assisted catalysis" mechanism that differentiates it from other acyltransferases. In this mechanism, the acylation of glycerol-3-phosphate proceeds without requiring a catalytic base from the enzyme itself .

Traditional acyltransferases typically utilize a catalytic residue (often histidine or cysteine) that functions as a base to deprotonate the hydroxyl group of the acyl acceptor, facilitating nucleophilic attack on the acyl donor. In contrast, PlsY's substrate-assisted mechanism likely involves the phosphate group of G3P functioning as the catalytic base, activating its own hydroxyl group for nucleophilic attack on the acyl-phosphate substrate.

This mechanistic difference is reflected in PlsY's unique active site architecture, which has been elucidated through multiple substrate- and product-bound structures. These structures reveal the atomic details of the relatively inflexible active site that accommodates both the acyl-phosphate donor and the G3P acceptor in a precise orientation to facilitate the acyl transfer reaction .

What expression systems are commonly used for recombinant production of PlsY?

Expression SystemAdvantagesLimitationsYieldPurification Tags
E. coliHigh expression levels, well-established protocols, cost-effectiveMay form inclusion bodies, potential toxicity due to membrane protein overexpression2-5 mg/L cultureHis6, MBP, GST
Insect cellsBetter membrane protein folding, post-translational modificationsHigher cost, longer expression time1-3 mg/L cultureHis6, FLAG
Cell-free systemsAvoids toxicity issues, rapid expressionExpensive, limited scalability0.5-1 mg/mg reactionHis6, Strep-tag
Native host (S. aureus)Authentic folding environmentPathogenicity concerns, lower yields0.1-0.5 mg/L cultureHis6

What are the optimal conditions for measuring recombinant PlsY enzymatic activity?

Measuring the enzymatic activity of recombinant PlsY requires careful consideration of multiple factors to ensure physiologically relevant results. Based on the structural and mechanistic insights from crystallographic studies, the following conditions are recommended:

ParameterOptimal ConditionNotes
Buffer50 mM HEPES, pH 7.5Maintains physiological pH without interfering with activity
Salt100-150 mM NaClProvides ionic strength similar to bacterial cytoplasm
Detergent0.03-0.05% DDM or 0.1% CHAPSCritical for stabilizing membrane protein; concentration should be above CMC
Temperature30-37°CReflects physiological conditions for S. aureus
G3P concentration50-500 μMSpans typical Km range
Acyl-phosphate10-100 μM acyl-P (C16-C18)Natural substrate range; solubility may limit upper concentration
Assay methodsRadiometric, coupled-enzyme, LC-MSDifferent methods provide complementary information
ControlsHeat-inactivated enzyme, reaction without G3PEssential to confirm enzyme-specific activity

Activity assays for PlsY typically monitor either the consumption of substrates (G3P and acyl-phosphate) or the formation of product (lysophosphatidic acid). The choice of detection method depends on the specific research question, available equipment, and desired sensitivity. It's important to note that the unusual acyl-phosphate substrate may require custom synthesis or enzymatic preparation before use in activity assays .

What approaches can be used to investigate the substrate specificity of recombinant PlsY?

Investigating the substrate specificity of PlsY requires a comprehensive approach that examines both the acyl-phosphate donor and the glycerol-3-phosphate acceptor. Several complementary methods can be employed:

  • Kinetic analysis with varied substrates: Determine kinetic parameters (Km, kcat, kcat/Km) for different acyl-phosphate chain lengths (C8-C20) and saturation states (saturated, mono-unsaturated, poly-unsaturated).

  • Structural analysis: Use X-ray crystallography with different bound substrates to visualize substrate binding modes and identify key interaction residues .

  • Site-directed mutagenesis: Based on structural insights, mutate residues in the binding pocket to alter specificity and test functional consequences.

  • Competition assays: Measure inhibition patterns when multiple potential substrates are present simultaneously.

  • Molecular dynamics simulations: Model substrate binding and predict energetics of different substrate-enzyme interactions.

The substrate specificity of PlsY is particularly interesting because it uses the unusual acyl-phosphate as an acyl donor, rather than the more common acyl-CoA or acyl-carrier protein used by other acyltransferases. This unique substrate preference likely reflects specific structural adaptations in the enzyme's binding pocket and contributes to its distinctive catalytic mechanism .

How can recombinant PlsY stability be optimized for structural studies?

The stability of recombinant PlsY is critical for structural studies, particularly crystallography. Based on the successful determination of PlsY's crystal structure at 1.48 Å resolution, several approaches can be implemented:

Stabilization StrategyImplementationImpact on Structural Studies
Detergent screeningTest multiple detergents (DDM, LMNG, DM, CHAPS)Critical for extracting and maintaining protein in native-like environment
Lipid supplementationAdd specific phospholipids (PE, PG, cardiolipin)Mimics native membrane environment, enhances stability
Buffer optimizationScreen pH (6.5-8.0), salt (100-500 mM), additivesIdentifies conditions that minimize aggregation and unfolding
Thermostability assaysCPM assay, nanoDSF, or SEC-MALSQuantitatively assesses stability under different conditions
Ligand additionInclude substrates or product analogsStabilizes protein in specific conformational states
Protein engineeringIntroduce disulfide bonds, remove flexible regionsCan enhance crystallizability but may affect function

The successful crystal structure determination of PlsY was achieved using crystals grown in a lipid bilayer environment that supported enzyme activity, suggesting that maintaining a native-like membrane environment is crucial for structural integrity . The relatively inflexible active site of PlsY may contribute to its structural stability, making it amenable to crystallization when appropriate conditions are provided.

What are the methodological challenges in studying inhibitors of recombinant PlsY as potential antimicrobials?

Developing inhibitors against PlsY presents several methodological challenges that must be addressed systematically:

  • Membrane protein targeting: As a seven-transmembrane helix protein, PlsY presents challenges for inhibitor accessibility and specificity .

  • Assay development: Creating robust, high-throughput assays for PlsY activity requires careful consideration of the unusual acyl-phosphate substrate availability and detection methods.

  • Inhibitor design strategies:

ApproachAdvantagesChallengesConsiderations
Substrate analogsTarget known binding sitesMay lack specificity between bacterial speciesRequire knowledge of substrate binding determinants
Structure-based designRational approach based on crystal structureMay not account for protein dynamicsNeed high-resolution structures with bound substrates
Fragment screeningIdentifies novel chemical scaffoldsLow initial potencyRequires sensitive detection methods
Natural product screeningMay identify novel mechanismsIdentification of active componentsExtract preparation and fractionation
Phenotypic screeningIdentifies compounds with cellular activityTarget validation requiredMust confirm PlsY as the target
  • Translational challenges: Moving from in vitro inhibition to effective antimicrobials requires addressing:

    • Membrane permeability in Gram-positive and Gram-negative bacteria

    • Potential efflux of compounds

    • Off-target effects on host lipid metabolism

    • Pharmacokinetic and pharmacodynamic properties

  • Resistance mechanisms: Understanding potential resistance pathways through mutation of PlsY or activation of alternative metabolic routes.

Since PlsY is essential and ubiquitous in bacteria but lacks eukaryotic homologs, it represents an attractive antimicrobial target. Previous studies have identified several PlsY inhibitors as potential antimicrobials, suggesting that overcoming these methodological challenges could lead to valuable new therapeutic agents .

How does the function of PlsY in S. aureus relate to its pathogenesis and abscess formation?

The relationship between PlsY function and S. aureus pathogenesis, particularly abscess formation, involves several interconnected mechanisms:

S. aureus is a significant human pathogen that causes skin and soft tissue abscesses through a series of coordinated processes. While abscess formation has traditionally been viewed as a host defense mechanism, evidence suggests that S. aureus actively promotes abscess formation to enhance its survival and dissemination .

The phospholipid membrane synthesized through pathways involving PlsY provides the structural foundation for bacterial replication within abscesses. As S. aureus enters tissue, it attracts immune cells and organizes itself as a staphylococcal abscess community (SAC) at the center of the lesion, protected from host immune cells by a fibrin pseudocapsule .

Within these structured abscesses, S. aureus can survive within polymorphonuclear neutrophils (PMNs) or monocytes, potentially using these leukocytes as vehicles to seed new infection sites. This process requires intact bacterial membranes and metabolic functionality, which depend on phospholipid biosynthesis pathways involving PlsY .

The relationship between PlsY activity and abscess formation represents a potential target for therapeutic intervention. Inhibiting PlsY could compromise membrane integrity and phospholipid biosynthesis, potentially reducing the ability of S. aureus to establish and maintain abscess communities, thereby limiting infection progression and dissemination.

What are the best practices for designing site-directed mutagenesis experiments to study PlsY function?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in PlsY. Based on crystallographic data showing PlsY's seven-transmembrane helix structure and substrate binding interactions, targeted mutations can provide valuable insights into catalytic mechanisms and substrate specificity .

Mutagenesis TargetRationaleExpected OutcomeTechnical Considerations
Active site residuesDirectly test catalytic hypothesisAltered enzyme kineticsMay completely abolish activity
Substrate binding pocketProbe determinants of specificityChanged substrate preferenceConsider conservative substitutions
Transmembrane helicesExamine membrane integrationAltered expression or stabilityMay affect protein folding
Protein-protein interaction sitesInvestigate potential complexesModified protein associationsCo-expression with partners may be needed
Surface-exposed residuesCreate epitope tags or crystallization aidsEnhanced detection or crystallizationMinimal functional impact expected

When designing mutagenesis experiments, consider the following best practices:

  • Structure-guided approach: Utilize the high-resolution crystal structure of PlsY (1.48 Å) to identify critical residues for mutation .

  • Conservative substitutions: Begin with conservative amino acid changes to minimize disruption of protein folding.

  • Multiple functional assays: Assess both enzyme activity and protein stability/folding for each mutant.

  • Control mutations: Include known inactivating mutations and surface mutations with minimal expected impact.

  • Complementary techniques: Combine mutagenesis with other approaches (e.g., inhibitor binding, substrate analog studies) for comprehensive insights.

The "substrate-assisted catalysis" mechanism proposed for PlsY, which does not require a proteinaceous catalytic base, presents a particularly interesting target for mutagenesis studies. Mutations affecting substrate positioning rather than direct catalysis may have the most significant impact on enzyme function .

What techniques can be employed to characterize the interaction between PlsY and potential inhibitors?

Characterizing interactions between PlsY and potential inhibitors requires a multi-faceted approach that combines structural, biochemical, and computational methods:

  • Structural methods:

    • X-ray crystallography with bound inhibitors (as achieved for PlsY at 1.48 Å)

    • Cryo-electron microscopy for larger complexes

    • NMR for dynamic aspects of binding

  • Biochemical and biophysical techniques:

TechniqueInformation ProvidedAdvantagesLimitations
Enzyme inhibition assaysIC50, Ki values, mode of inhibitionDirect functional relevanceRequires active enzyme preparation
Isothermal titration calorimetry (ITC)Binding affinity, stoichiometry, thermodynamicsLabel-free, complete thermodynamic profileRequires significant amount of pure protein
Surface plasmon resonance (SPR)Association/dissociation kineticsReal-time binding, low protein requirementSurface immobilization may affect function
Microscale thermophoresis (MST)Binding affinity in near-native conditionsWorks with membrane proteins, low sample consumptionRequires fluorescent labeling
Thermal shift assaysStabilization upon bindingHigh-throughput, minimal protein requirementIndirect measure of binding
  • Computational approaches:

    • Molecular docking to predict binding modes

    • Molecular dynamics simulations to capture binding dynamics

    • Free energy calculations to estimate binding affinities

  • Cellular validation:

    • Minimum inhibitory concentration (MIC) determination

    • Macromolecular synthesis assays to confirm target pathway inhibition

    • Resistant mutant generation and characterization

The combination of these approaches provides comprehensive insights into inhibitor interactions, guiding the optimization of lead compounds. The availability of high-resolution structures of PlsY with substrates and products bound offers a particularly valuable foundation for structure-based inhibitor design and characterization .

What are the future directions for research on recombinant S. aureus PlsY?

Future research on recombinant S. aureus PlsY will likely focus on several promising directions that build upon the significant structural and functional insights already gained:

  • Antimicrobial development: The unique structural features of PlsY, its essential role in bacterial phospholipid biosynthesis, and its absence in eukaryotes make it an attractive target for antimicrobial development . Future work will likely focus on structure-based design of specific inhibitors and their optimization for clinical applications.

  • Comparative studies across bacterial species: As PlsY is ubiquitous in bacteria, comparative studies across different pathogens could reveal species-specific features that might be exploited for selective targeting.

  • Systems biology integration: Understanding how PlsY activity is regulated within the broader context of bacterial metabolism and stress responses, particularly during infection and abscess formation .

  • Membrane biology insights: PlsY's seven-transmembrane helix structure provides an excellent model system for studying membrane protein folding, stability, and function .

  • Novel catalytic mechanisms: Further investigation of the "substrate-assisted catalysis" mechanism proposed for PlsY could reveal new paradigms in enzyme catalysis .

  • Technological advances:

    • Cryo-electron microscopy to visualize PlsY in different conformational states

    • Advanced computational methods to model membrane protein dynamics

    • Development of novel activity-based probes for in vivo studies

  • Translational applications: Beyond antimicrobials, insights from PlsY research could inform bioengineering applications, such as the production of novel phospholipids or membrane-modifying enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.