Recombinant Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate acyltransferase (crtO)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate Acyltransferase (CrtO)

Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate acyltransferase, commonly referred to as CrtO, is an enzyme involved in the biosynthesis of staphyloxanthin, a carotenoid pigment responsible for the characteristic golden color of Staphylococcus aureus . Staphyloxanthin contributes to the bacterium's virulence by providing protection against oxidative stress and enhancing resistance to antimicrobial peptides . CrtO catalyzes the final step in the staphyloxanthin biosynthetic pathway . Specifically, it facilitates the esterification of glucose at the C6'' position with the carboxyl group of 12-methyltetradecanoic acid, yielding staphyloxanthin .

Nomenclature and Classification

ItemDescription
Systematic NameGlycosyl-4,4'-diaponeurosporenoate acyltransferase
Synonyms4,4'-diaponeurosporenoate glycosyltransferase
EC Number2.4.1.-
Encoding GenecrtO
UniProt IDQ2FV58
Enzyme ClassificationHexosyltransferases

Biochemical Function

CrtO functions as an acyltransferase in the final step of staphyloxanthin biosynthesis . The enzyme utilizes glycosyl-4,4'-diaponeurosporenoate and 12-methyltetradecanoic acid as substrates to produce staphyloxanthin . The reaction can be summarized as follows:

Glycosyl-4,4'-diaponeurosporenoate + 12-methyltetradecanoic acid → Staphyloxanthin

This esterification is crucial for the completion of the staphyloxanthin molecule, which plays a significant role in the virulence and survival of S. aureus .

Biosynthetic Pathway of Staphyloxanthin

The biosynthesis of staphyloxanthin involves several enzymatic steps, with CrtO catalyzing the final acylation . The pathway is initiated by CrtM, a dehydrosqualene synthase, which catalyzes the head-to-head condensation of two molecules of farnesyl diphosphate to form dehydrosqualene . The subsequent steps involve:

  1. Dehydrogenation of dehydrosqualene to 4,4'-diaponeurosporene by CrtN .

  2. Oxidation of 4,4'-diaponeurosporene to 4,4'-diaponeurosporenic acid by CrtP .

  3. Esterification of glucose at the C1'' position of 4,4'-diaponeurosporenic acid to form glycosyl-4,4'-diaponeurosporenoate by CrtQ .

  4. Acylation of glycosyl-4,4'-diaponeurosporenoate with 12-methyltetradecanoic acid by CrtO to form staphyloxanthin .

Role in Virulence and Antibiotic Resistance

Staphyloxanthin, produced by the action of CrtO, is a crucial virulence factor in S. aureus . It acts as an antioxidant, protecting the bacteria from reactive oxygen species (ROS) produced by the host immune system . By neutralizing ROS, staphyloxanthin enhances the survival of S. aureus during infection . Additionally, staphyloxanthin contributes to the resistance against antimicrobial peptides, thereby increasing the bacterium's ability to withstand the effects of antibiotics .

Research Findings and Mutant Studies

Studies involving crtO deletion mutants have demonstrated the importance of CrtO in staphyloxanthin production and bacterial virulence . These mutants typically exhibit:

  • Reduced staphyloxanthin production, leading to a loss of the characteristic golden color .

  • Increased sensitivity to oxidative stress .

  • Decreased resistance to antimicrobial peptides .

  • Attenuated virulence in animal models of infection .

These findings confirm the critical role of CrtO in the biosynthesis of staphyloxanthin and its subsequent impact on the pathogenicity of S. aureus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
crtO; SAUSA300_2502; Glycosyl-4,4'-diaponeurosporenoate acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-165
Protein Length
Full Length of Mature Protein
Species
Staphylococcus aureus (strain USA300)
Target Names
crtO
Target Protein Sequence
GTRIPDKYFRQKYIIFKSFNFEKHGKFWNKWFYVRKWKHKILDGHQLNQNIYDQRHLMTI NTDEIEKMIIETKRAELIHWISILPVIIFNKGPRLVKYINIFYAMIANVPIIIVQRYNRP RLTQLLRILKRRGERHD
Uniprot No.

Target Background

Function

This enzyme catalyzes the acylation of glycosyl-4,4'-diaponeurosporenoate. Specifically, it esterifies glucose at the C6'' position with the carboxyl group of the C(15) fatty acid 12-methyltetradecanoic acid, producing staphyloxanthin. This is the final step in the biosynthesis of this orange pigment, prevalent in most Staphylococcus strains.

Database Links
Protein Families
Acyltransferase CrtO family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of crtO in the staphyloxanthin biosynthetic pathway?

CrtO functions as an acyltransferase in the final step of staphyloxanthin biosynthesis. It specifically esterifies glucose at the C6'' position with the carboxyl group of 12-methyltetradecanoic acid to yield staphyloxanthin, which is the orange pigment present in most staphylococci strains . The complete staphyloxanthin biosynthetic pathway involves six enzymes: CrtM (dehydrosqualene synthase), CrtN (dehydrosqualene desaturase), CrtP (mixed function oxidase), CrtQ (glycosyltransferase), CrtO (acyltransferase), and AldH (4,4'-diaponeurosporen-aldehyde dehydrogenase) . Understanding this enzymatic cascade is crucial for studying S. aureus virulence mechanisms.

How is the staphyloxanthin biosynthetic pathway organized in S. aureus?

The staphyloxanthin biosynthetic pathway involves a sequential enzymatic process starting with dehydrosqualene synthesis by CrtM, followed by dehydrogenation by CrtN to form 4,4'-diaponeurosporene. CrtP then oxidizes the terminal methyl group to form 4,4'-diaponeurosporenic acid. Next, CrtQ esterifies glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid to yield glycosyl 4,4'-diaponeurosporenoate. Finally, CrtO esterifies glucose at the C6'' position with 12-methyltetradecanoic acid to produce staphyloxanthin . Recent research has identified a sixth enzyme, 4,4'-diaponeurosporen-aldehyde dehydrogenase (AldH), which is required for complete staphyloxanthin biosynthesis but is located 670 kilobase pairs away from the main gene cluster .

Why is studying recombinant crtO relevant to S. aureus pathogenicity?

Studying recombinant crtO is relevant to S. aureus pathogenicity because staphyloxanthin serves as a virulence factor. The golden pigment produced through the activity of crtO and other biosynthetic enzymes contributes to the pathogen's resistance mechanisms . Research methodologies focusing on recombinant crtO can help elucidate potential targets for anti-virulence therapies, particularly important given the rise of methicillin-resistant S. aureus (MRSA) and its resistance to β-lactam antibiotics. By understanding the structure-function relationships of crtO, researchers can develop strategies to inhibit staphyloxanthin biosynthesis, potentially reducing bacterial virulence without selecting for resistance.

What experimental approaches are optimal for functional characterization of recombinant crtO?

For functional characterization of recombinant crtO, researchers should consider heterologous expression systems coupled with activity assays that track the conversion of glycosyl-4,4'-diaponeurosporenoate to staphyloxanthin. Successful expression of crtO has been achieved in Escherichia coli through both artificial synthetic operons and the wild-type operon (crtOPQMN) .

Experimental design should include:

  • Expression vector selection with appropriate promoters (e.g., T7 or arabinose-inducible systems)

  • Optimization of induction conditions (temperature, inducer concentration, duration)

  • Development of enzymatic assays to measure acyltransferase activity

  • HPLC-MS analysis to detect and quantify the conversion of substrate to product

  • Comparative analysis with mutated variants to identify critical residues

When expressing the staphyloxanthin pathway, researchers should be aware that expression of only the five previously known enzymes (CrtO, CrtP, CrtQ, CrtM, and CrtN) in E. coli results in the accumulation of carotenoid aldehyde intermediates without complete conversion to staphyloxanthin, highlighting the importance of including AldH in recombinant expression studies .

How can structure-function studies of crtO inform enzyme engineering approaches?

Structure-function studies of crtO can inform enzyme engineering through systematic mutagenesis coupled with activity assays. Drawing from methodologies applied to related enzymes like CrtW ketolase, researchers should consider:

  • Alanine-scanning mutagenesis to identify critical residues required for catalytic function

  • Site-directed mutagenesis of conserved domains to assess their role in substrate binding and catalysis

  • Random mutagenesis coupled with color screening for improved variants

  • Molecular modeling to predict structural features that influence substrate specificity

Research on the related β-carotene ketolase (CrtW) has shown that random mutagenesis can identify improved variants (e.g., L175M, M99V, and M99I) with enhanced catalytic activity . Similar approaches could be applied to crtO, potentially generating variants with altered substrate specificity or improved catalytic efficiency. Additionally, partial inactivation of enzymes through specific mutations can lead to the accumulation of pathway intermediates, which may be useful for studying the reaction mechanism of crtO .

What are the considerations for co-expressing crtO with other staphyloxanthin pathway enzymes?

When co-expressing crtO with other staphyloxanthin pathway enzymes, researchers should consider several key factors:

  • Operon design: The natural organization of genes in the staphyloxanthin pathway provides a template, but researchers may need to optimize gene arrangement for heterologous expression. The core genes (crtOPQMN) are clustered together, while AldH is located 670 kb away in the S. aureus genome .

  • Balancing expression levels: Ensuring appropriate stoichiometry between pathway enzymes is crucial. This can be achieved through:

    • Using different strength promoters

    • Employing varying copy number plasmids

    • Designing synthetic ribosome binding sites with calibrated strengths

  • Metabolic burden: Overexpression of multiple enzymes can strain cellular resources. Researchers should optimize induction conditions and consider using dual-plasmid systems as demonstrated in studies using pSUKMZX and pSU18 vectors .

  • Substrate availability: Ensuring adequate precursor supply is essential for pathway functionality. The identification of bottlenecks, such as the conversion of aldehyde intermediates to carboxylic acids requiring AldH, highlights the importance of complete pathway reconstruction .

How do experimental conditions affect recombinant crtO activity and stability?

The activity and stability of recombinant crtO are influenced by several experimental parameters that should be systematically evaluated:

  • Buffer composition: pH, ionic strength, and specific ions can affect enzyme folding and catalytic activity

  • Temperature: Both expression temperature and assay temperature impact stability and activity

  • Detergents/solubilizers: As a membrane-associated enzyme, crtO may require specific detergents for optimal activity

  • Reducing agents: The presence of DTT or β-mercaptoethanol may affect disulfide bond formation

  • Storage conditions: Protein stability during purification and storage requires optimization

Researchers should design factorial experiments to identify optimal conditions, measuring activity through HPLC-MS detection of staphyloxanthin formation. Thermal shift assays can help determine conditions that enhance protein stability, while activity assays under varying conditions can identify optimal reaction parameters.

What are the best expression systems for producing functional recombinant crtO?

Based on existing research, several expression systems have proven effective for producing functional recombinant crtO:

Expression SystemAdvantagesLimitationsReference
E. coli with pBAD vectorTight regulation of expression, suitable for potentially toxic proteinsMay require optimization of rare codons
E. coli with dual plasmid system (pSUKMZX + additional vector)Allows separation of crtO from other pathway genes for modular testingRequires selection with multiple antibiotics
E. coli with synthetic operonsEnables optimized gene arrangement and expression levelsMay not reflect natural regulatory mechanisms
S. carnosus expressionNative-like environment for staphylococcal proteinsMore challenging genetic manipulation than E. coli

When designing expression constructs, researchers should consider adding affinity tags (His6, FLAG, etc.) for purification, but should verify that these do not interfere with enzyme activity. Additionally, codon optimization for the host organism may improve expression levels, especially for the GC-rich sequences often found in Staphylococcus aureus genes.

What purification strategies are most effective for obtaining active crtO enzyme?

Effective purification of active crtO enzyme requires strategies that maintain the native conformation of this membrane-associated protein:

  • Initial extraction: Use mild detergents (e.g., DDM, CHAPS, or Triton X-100) to solubilize the enzyme from membranes

  • Affinity chromatography: His-tagged constructs enable purification via nickel affinity chromatography

  • Buffer optimization: Include glycerol (10-20%) and reducing agents to maintain stability

  • Size exclusion chromatography: For final polishing and to ensure monodispersity

  • Activity verification: Test purified fractions using substrate conversion assays

Researchers should be aware that membrane-associated enzymes like crtO often require detergent micelles throughout the purification process to maintain their native conformation and activity. Additionally, activity assays should be performed at each purification step to track the recovery of functional enzyme.

How can researchers design randomized controlled trials to evaluate crtO inhibitors?

Designing randomized controlled trials (RCTs) to evaluate crtO inhibitors should follow established principles for experimental research:

  • Participant selection: Clearly define the experimental units (bacterial strains, animal models, etc.) and ensure they are drawn from a relevant population .

  • Randomization: Use proper randomization techniques to assign experimental units to treatment groups (crtO inhibitor) and control groups (vehicle or no treatment) .

  • Outcome measures: Define primary endpoints (e.g., staphyloxanthin production, virulence in infection models) and secondary endpoints (e.g., bacterial growth, resistance development).

  • Controlled conditions: Maintain equivalent conditions between treatment and control groups except for the intervention being tested .

  • Sample size calculation: Perform power analysis to ensure sufficient statistical power to detect meaningful effects.

For in vitro inhibitor screening, researchers should test multiple concentrations to establish dose-response relationships and include appropriate controls:

  • Positive controls (known inhibitors if available)

  • Negative controls (vehicle only)

  • Target validation controls (crtO knockout strains)

For in vivo studies evaluating virulence attenuation through crtO inhibition, researchers should follow the RCT design principles while adhering to ethical guidelines for animal experimentation .

How should researchers interpret contradictory results in crtO functional studies?

When encountering contradictory results in crtO functional studies, researchers should systematically investigate potential sources of variability:

  • Strain-specific differences: Variations in the crtO gene sequence or regulation between S. aureus strains may explain divergent results. Cross-referencing with genome databases can identify strain-specific polymorphisms.

  • Expression conditions: Different culture conditions can dramatically affect enzyme expression and activity. Researchers should standardize media composition, growth phase at harvest, and induction parameters.

  • Assay methodology: Discrepancies may arise from differences in assay sensitivity, specificity, or detection methods. Standardizing activity assays and product detection methods is essential.

  • Interaction with other pathway components: Complete staphyloxanthin biosynthesis requires the coordinated action of six enzymes. The absence of AldH in early studies led to accumulation of intermediates rather than complete conversion to staphyloxanthin, highlighting how our understanding of biochemical pathways evolves .

  • Post-translational modifications: If crtO requires specific modifications for activity, expression in heterologous systems may yield inconsistent results.

Researchers should adopt a multi-method approach to verify findings, including both in vitro biochemical assays and in vivo complementation studies.

What bioinformatic approaches can improve our understanding of crtO structure and function?

Several bioinformatic approaches can enhance our understanding of crtO structure and function:

  • Sequence alignment and conservation analysis: Identifying conserved residues across acyltransferase families can highlight catalytically important regions. Similar approaches applied to ketolases have identified critical residues through alanine-scanning mutagenesis .

  • Homology modeling: In the absence of crystal structures, homology models based on related acyltransferases can predict structural features of crtO.

  • Molecular docking: Computational docking of substrates (glycosyl-4,4'-diaponeurosporenoate and 12-methyltetradecanoic acid) can predict binding modes and catalytic mechanisms.

  • Genomic context analysis: Examining the chromosomal organization of crtO and related genes across Staphylococcus species can provide insights into evolutionary relationships and functional interactions.

  • Protein-protein interaction prediction: Computational methods can help identify potential interactions between crtO and other staphyloxanthin pathway enzymes.

These approaches should be validated experimentally, using techniques such as site-directed mutagenesis to confirm the importance of predicted catalytic residues.

What technological innovations could advance our understanding of crtO catalytic mechanisms?

Several emerging technologies could significantly advance our understanding of crtO catalytic mechanisms:

  • Cryo-electron microscopy: This technique could help determine the structure of crtO in complex with substrates or inhibitors, potentially revealing conformational changes during catalysis.

  • Time-resolved spectroscopy: These methods could track the formation of reaction intermediates during crtO-catalyzed reactions, providing insights into reaction kinetics and mechanisms.

  • Single-molecule enzymology: Observing individual enzyme molecules could reveal heterogeneity in catalytic behavior and identify transient states not detectable in bulk measurements.

  • Directed evolution coupled with deep mutational scanning: These approaches could systematically map the relationship between crtO sequence and function, identifying residues critical for substrate specificity and catalytic efficiency.

  • Synthetic biology approaches: Reconstituting the complete staphyloxanthin pathway in heterologous hosts with engineered variants of crtO could enable high-throughput screening for improved variants or inhibitors.

Each of these technologies offers unique advantages for understanding different aspects of crtO function, from atomic-level structural details to systems-level pathway integration.

How might crtO research inform the development of novel anti-virulence strategies?

Research on crtO has significant implications for developing novel anti-virulence strategies against S. aureus:

  • Target validation: The role of staphyloxanthin as a virulence factor makes crtO a potential target for anti-virulence therapies that could reduce bacterial pathogenicity without selecting for resistance .

  • Inhibitor design: Structural and functional characterization of crtO can guide rational design of inhibitors that block staphyloxanthin production, potentially rendering S. aureus more susceptible to immune clearance.

  • Screening platforms: Functional expression of crtO in E. coli provides a platform for high-throughput screening of chemical libraries for potential inhibitors .

  • Combination therapies: Inhibitors targeting crtO could potentially be combined with conventional antibiotics to enhance treatment efficacy, particularly against drug-resistant strains.

  • Biomarker development: Understanding the regulation and activity of crtO could lead to diagnostic tools that predict virulence potential or drug susceptibility of clinical isolates.

As antibiotic resistance continues to rise, these anti-virulence approaches targeting crtO represent promising alternatives that could disarm pathogens without directly killing them, potentially reducing selective pressure for resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.