Recombinant Staphylococcus aureus Heme sensor protein hssS (hssS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
hssS; NWMN_2264; Heme sensor protein HssS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Staphylococcus aureus (strain Newman)
Target Names
hssS
Target Protein Sequence
MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKP THIQQYFKHLGQMNYQIMTIDQKGHKTFYGEPFREDTLSQNAINNVLNNQDYHGIKDKPF ALFVTGFFDNVTDNTVGINFKTKDGSIAVFMRPDIGETFSEFRTFLAVLLMLLLFISISL VIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLGQVDQMR QHFVQNVSHEIKTPLTHIHHLLSELQQTSDKTLRQQYINDIYTITTQLSGLTTELLLLSE LDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNL LINAIKYTDVGGAIDIALQHSHNNIIFTISNDGSPISPQAEARLFERFYKVSKHDNSNGL GLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNSL
Uniprot No.

Target Background

Function

Recombinant Staphylococcus aureus Heme Sensor Protein hssS (hssS)

HssS is a component of the two-component regulatory system HssS/HssR, crucial for intracellular heme homeostasis and modulation of staphylococcal virulence. As a heme sensor histidine kinase, HssS undergoes autophosphorylation at a histidine residue, subsequently transferring the phosphate group to an aspartate residue on HssR. The HssR/HssS complex activates expression of hrtAB, an efflux pump, in response to extracellular heme, hemin, hemoglobin, or blood.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is HssS and what is its primary function in Staphylococcus aureus?

    HssS is a membrane sensor protein in Staphylococcus aureus that functions as part of the HssRS two-component system (TCS), which detects and responds to heme toxicity. When activated by heme, HssS initiates a phosphotransfer mechanism that leads to the expression of the heme responsive transporter (HrtAB), a heme efflux system that prevents intracellular accumulation of toxic heme. This "gatekeeper" mechanism serves to limit intracellular diffusion of exogenous heme in S. aureus, creating a protective barrier that allows the bacterium to survive in heme-rich environments like the bloodstream .

  • How does S. aureus encounter heme in host environments?

    In mammalian blood, S. aureus encounters heme when it causes hemolysis (the bursting of red blood cells). Red blood cells contain large amounts of heme, which is used for oxygen binding. When S. aureus induces hemolysis in the bloodstream, it releases heme from red blood cells. Although heme is toxic to bacteria when located outside red blood cells, S. aureus has evolved mechanisms to detect and respond to this threat through the HssS sensor protein . This interaction is particularly important for pathogenesis as S. aureus is a leading cause of bacteremia and endocarditis, conditions where the pathogen encounters significant amounts of heme in the bloodstream .

  • What structural domains are important for HssS function?

    Structural and functional data reveal a heme-binding hydrophobic cavity in HssS within the transmembrane domains (TM) at the interface with the extracellular domain. This structural pocket contains conserved residues critical for HssS function as a heme sensor. Specifically, single substitutions of key arginines and two highly conserved phenylalanines (Phe25 and Phe128) in the predicted hydrophobic pocket limit the ability of HssS to induce HrtBA synthesis. Combining four specific substitutions completely abolishes HssS activation. This hydrophobic structural domain with two conserved anchoring arginines at the interface between the membrane and extracellular domain is predicted to accommodate heme binding .

  • How can researchers measure HssS activation in experimental systems?

    Researchers can assess HssS activation through several established methodologies:

    • Protein expression analysis: Using antibodies against tagged versions of HssS (such as HA-tagged HssS) and HrtB to detect their expression levels via Western blotting. While HrtB expression increases in the presence of heme, HssS expression typically remains constant .

    • Promoter activity measurement: Using β-galactosidase (β-gal) expression from a promoter fusion (e.g., PhrtBA-lac) to measure HssS-dependent activation of HrtBA expression in response to heme .

    • Heme adaptation assay: Testing the ability of S. aureus to adapt to heme toxicity by growing overnight cultures in subinhibitory levels of heme, then challenging with toxic concentrations of heme. Activation of the HssRS TCS enables robust growth in otherwise toxic heme concentrations .

Advanced Research Questions

  • What are the most effective strategies for producing recombinant HssS protein for structural and functional studies?

    Production of recombinant HssS requires careful consideration of expression systems due to its membrane-associated nature. Based on successful approaches with similar proteins:

    • Expression system selection: While bacterial expression systems like E. coli are commonly used, mammalian cell expression systems such as HEK293F cells can provide better folding and post-translational modifications for membrane proteins. For HssS specifically, E. coli-based expression has been successfully employed, as evidenced by studies showing that wild-type HssS copurifies with heme from E. coli .

    • Protein purification strategy: For membrane proteins like HssS, purification typically involves:

      1. Membrane fraction isolation through differential centrifugation

      2. Solubilization using appropriate detergents

      3. Affinity chromatography (utilizing His-tags or other fusion tags)

      4. Size exclusion chromatography for final purification

    • Maintaining protein stability: Addition of stabilizing agents such as glycerol (10-15%) and careful pH optimization (typically pH 7.4-8.0) are crucial for maintaining the native conformation of membrane proteins during purification .

    • Verification of function: Purified recombinant HssS should be verified for heme binding capability, as wild-type HssS binds heme while variants with mutations in the binding pocket show attenuated binding .

  • How can researchers design experiments to determine if candidate molecules inhibit HssS-heme interaction?

    A systematic experimental design approach includes:

    1. Preliminary screening assay setup:

      • Establish a reproducible in vitro heme-binding assay using purified recombinant HssS

      • Determine optimal buffer conditions, protein concentration, and heme concentration

      • Develop a high-throughput screening protocol with appropriate controls

    2. Statistical design considerations:

      • Implement robust data preprocessing methods to reduce unwanted variation

      • Include replicate measurements to estimate random error magnitude

      • Use formal statistical models to benchmark putative hits against chance expectations

      • Apply ROC (Receiver Operating Characteristic) analyses to optimize true-positive rates

    3. Validation cascade:

      • Confirm hits with dose-response curves

      • Perform biophysical validation using techniques like surface plasmon resonance (SPR)

      • Validate in cellular systems using the heme adaptation assay or HrtBA expression assays

      • Assess effects on bacterial survival in heme-rich environments

    4. Control experiments:

      • Include HssS variants with mutations in the heme-binding pocket as positive controls

      • Evaluate compound specificity using related bacterial heme sensors

      • Test for non-specific membrane effects or general toxicity

  • What methodologies can be used to evaluate interactions between HssS and other components of the heme sensing pathway?

    To investigate HssS interactions within its signaling pathway, researchers can employ:

    1. Phosphotransfer analysis:

      • Use purified HssS and HssR proteins

      • Perform in vitro phosphorylation assays with radioactive [γ-32P]ATP

      • Analyze phosphotransfer kinetics from HssS to HssR

    2. Protein-protein interaction studies:

      • Use bacterial two-hybrid systems

      • Perform co-immunoprecipitation studies with tagged proteins

      • Employ FRET (Fluorescence Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer) for real-time interaction analysis in living cells

    3. Genetic interaction mapping:

      • Create double mutants affecting different components of the pathway

      • Analyze epistatic relationships through phenotypic characterization

      • Perform suppressor screens to identify compensatory mutations

    4. Membrane localization studies:

      • Use fluorescently tagged HssS to track subcellular localization

      • Perform fractionation studies to determine membrane association

      • Analyze protein dynamics using FRAP (Fluorescence Recovery After Photobleaching)

  • How do mutations in the heme-binding domain of HssS affect its signaling function and bacterial virulence?

    Mutational analysis of the HssS heme-binding domain has revealed:

    • Structure-function relationships: Single substitutions of conserved arginines and phenylalanines (Phe25 and Phe128) in the hydrophobic pocket partially reduce HssS function, while combinations of four substitutions completely abolish HssS activation .

    • Heme binding capacity: Wild-type HssS copurifies with heme from expression systems, whereas variants with mutations in the binding domain show significantly attenuated heme binding .

    • Signaling pathway impact: Mutations affecting heme binding consequently reduce HrtBA expression, impairing the bacterium's ability to detoxify heme.

    • Virulence effects: Laboratory trials demonstrate that S. aureus strains lacking functional HssS (incapable of detecting heme) exhibit substantially reduced virulence compared to wild-type strains. This directly links HssS function to pathogenicity in heme-rich environments like blood .

    Researchers investigating these relationships should employ complementation studies, where the wild-type hssS gene is reintroduced into mutant strains to confirm that observed phenotypes are specifically due to hssS mutations rather than polar effects or secondary mutations.

  • What is the role of HssS in different S. aureus clinical subphenotypes?

    Recent clinical subphenotype classification of S. aureus bacteremia has identified five distinct, reproducible clinical presentations. Understanding HssS function across these subphenotypes provides insights into pathogenesis:

    SubphenotypeCharacteristicsPotential HssS relevance
    ASAB associated with older age and comorbidityPotentially linked to reduced host defense against heme toxicity
    BNosocomial intravenous catheter-associated SAB in younger people without comorbidityMay involve biofilm formation where HssS function is altered
    CCommunity-acquired metastatic SABLikely high expression of HssS for survival in blood and tissues
    DSAB associated with chronic kidney diseasePotential adaptation to altered heme metabolism
    ESAB associated with injection drug useMay involve specialized adaptations to host defense mechanisms

    Researchers can investigate HssS expression levels and functional variations across these clinical subphenotypes to determine whether HssS contributes to the distinct clinical presentations and outcomes observed .

  • How can researchers design experiments to investigate the crosstalk between HssS and other two-component systems in S. aureus?

    Two-component systems (TCSs) in S. aureus show complex interactions that affect virulence. To investigate crosstalk between HssS and other TCSs:

    1. Global transcriptomics approach:

      • Compare gene expression profiles between wild-type, ΔhssS, and other TCS mutants under heme stress conditions

      • Identify overlapping and distinct gene expression patterns

      • Use RNA-seq to capture genome-wide effects of TCS cross-regulation

    2. Phosphotransfer specificity analysis:

      • Investigate interacting residues between HssS and HssR

      • Identify specificity determinants conserved within the same TCS

      • Compare with other NarL TCSs in S. aureus to understand divergent functional evolution

      • Examine conservation patterns between strains and species to identify selection pressures

    3. Purified protein cross-phosphorylation studies:

      • Express and purify multiple HKs and RRs from S. aureus

      • Perform in vitro phosphorylation assays testing non-cognate pairs

      • Quantify specificity and cross-talk potential between HssS and other HKs/RRs

    4. Genetic interaction studies:

      • Create double mutants affecting HssS and other TCSs

      • Analyze phenotypes related to heme adaptation, virulence factor production, and in vitro infection abilities

      • Identify synthetic effects that suggest functional relationships between systems

  • What are the best methods for analyzing HssS expression and activity in native S. aureus clinical isolates?

    Working with clinical isolates presents unique challenges. Recommended approaches include:

    1. Expression analysis in clinical isolates:

      • Generate antibodies specific to HssS or use epitope tagging approaches

      • Perform Western blotting to quantify HssS protein levels

      • Compare expression across different clinical isolates and growth conditions

    2. Genetic reporter integration:

      • Integrate promoter-reporter fusions (like PhrtBA-lac) into the chromosome

      • Measure reporter activity as a proxy for HssS/HssR function

      • Compare activation dynamics between reference strains and clinical isolates

    3. Heme adaptation phenotyping:

      • Test clinical isolates for their ability to adapt to increasing heme concentrations

      • Correlate adaptation phenotypes with genetic variations in hssS and related genes

      • Link phenotypic differences to clinical outcomes and antibiotic resistance profiles

    4. Sequencing and polymorphism analysis:

      • Perform targeted sequencing of hssS and regulatory regions

      • Identify naturally occurring variants that might affect function

      • Correlate genetic variations with expression levels and functional differences

Experimental Design and Analysis Questions

  • What controls should be included when studying HssS function in experimental systems?

    Proper experimental controls are critical for reliable HssS research. Key controls include:

    1. Genetic controls:

      • Wild-type S. aureus (positive control for normal HssS function)

      • ΔhssS mutant (negative control lacking HssS)

      • ΔhssS complemented with wild-type hssS (restoration control)

      • ΔhssS complemented with mutant hssS variants (structure-function controls)

    2. Expression controls:

      • Constitutive promoter controls to normalize for expression differences

      • Empty vector controls for plasmid-based expression

      • Inducible expression systems with uninduced controls

    3. Heme exposure controls:

      • Dose-response curves for heme exposure

      • Vehicle controls (e.g., DMSO) when heme is delivered in solvent

      • Time course controls to account for adaptation kinetics

      • Alternative porphyrins as specificity controls

    4. Host environment controls:

      • Growth in standard media versus heme-supplemented media

      • Comparisons between artificial media and biological fluids (serum, blood)

      • Controlled hemolysis conditions versus direct heme addition

  • How can statistical methods improve the identification of HssS inhibitors in high-throughput screening?

    Advanced statistical approaches enhance screening success:

    1. Robust data preprocessing methods:

      • Apply trimmed-mean polish methods to reduce unwanted variation

      • Remove row, column, and plate biases in high-throughput screening data

    2. Replicate design strategies:

      • Use technical replicates to estimate random error magnitude

      • Implement biological replicates to account for biological variation

      • Apply formal statistical models to benchmark potential hits against chance expectations

    3. Optimal statistical tests:

      • Implement the RVM t-test for superior power, particularly for small to moderate biological effects

      • Perform ROC analyses to optimize true-positive rates without increasing false-positive rates

    4. Hit selection criteria:

      • Establish clear thresholds based on statistical significance and effect size

      • Implement multi-parameter optimization for hit selection

      • Use machine learning approaches to identify patterns in complex datasets

    This systematic approach substantially improves hit identification in HssS inhibitor screens compared to simplified threshold methods, particularly for compounds with moderate but biologically significant effects.

  • What methodology should be employed to characterize the interaction between HssS and heme at the molecular level?

    Characterizing the HssS-heme interaction requires:

    1. Biophysical binding studies:

      • UV-visible spectroscopy to monitor Soret band shifts upon heme binding

      • Isothermal titration calorimetry (ITC) to determine binding affinity and thermodynamics

      • Surface plasmon resonance (SPR) for real-time binding kinetics

      • Fluorescence quenching assays if tryptophan residues are near the binding site

    2. Structural characterization:

      • X-ray crystallography of HssS with and without bound heme

      • NMR spectroscopy for solution structure and dynamics

      • Cryo-EM for membrane-embedded structural analysis

      • Computational docking and molecular dynamics simulations

    3. Mutagenesis approaches:

      • Alanine scanning of predicted binding pocket residues

      • Conservative vs. non-conservative substitutions to probe specific interactions

      • Chimeric proteins with related sensors to identify specificity determinants

    4. Spectroscopic characterization of bound heme:

      • Resonance Raman spectroscopy to determine heme coordination state

      • Electron paramagnetic resonance (EPR) to characterize the electronic structure

      • Magnetic circular dichroism (MCD) for electronic transitions analysis

  • How can researchers effectively compare HssS function across different Staphylococcus species and strains?

    Cross-species/strain comparative analysis requires:

    1. Sequence-based approaches:

      • Multiple sequence alignment of HssS proteins across Staphylococcus species

      • Phylogenetic analysis to identify evolutionary relationships

      • Identification of conserved vs. variable regions that might affect function

    2. Functional complementation:

      • Express heterologous HssS proteins in a ΔhssS S. aureus background

      • Quantify restoration of heme sensing and adaptation

      • Compare complementation efficiency across different species' HssS proteins

    3. Chimeric protein analysis:

      • Create domain-swapped chimeras between HssS proteins from different species

      • Map functional domains through complementation assays

      • Identify species-specific adaptations in sensing mechanism

    4. Comparative heme adaptation assays:

      • Standardize heme adaptation protocols across species

      • Compare adaptation dynamics and efficiency

      • Correlate adaptation phenotypes with natural habitat and pathogenicity

    This systematic comparison provides insights into how HssS function has evolved across Staphylococcus species and how these differences might contribute to niche adaptation and virulence potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.