Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
saeS; SAV0705; Histidine protein kinase SaeS; Sensor protein SaeS; Staphylococcus exoprotein expression protein S
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-351
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
saeS
Target Protein Sequence
MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS
Uniprot No.

Target Background

Function

SaeS is a membrane-associated histidine protein kinase belonging to the two-component regulatory system SaeR/SaeS. It plays a strain-dependent role in regulating staphylococcal virulence factors. SaeS likely functions as a kinase, autophosphorylating upon signal detection and subsequently activating the cytosolic response regulator, SaeR.

Database Links

KEGG: sav:SAV0705

STRING: 158878.SAV0705

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SaeRS two-component system and what role does SaeS play in it?

The SaeRS two-component system (TCS) is a major virulence regulatory system in Staphylococcus aureus that controls the expression of numerous virulence factors including alpha-hemolysin, coagulase, leukocidins, and fibronectin binding proteins . Within this system, SaeS functions as an intramembrane-sensing histidine kinase (IM-HK) that detects specific environmental signals and transmits them to the response regulator SaeR through phosphorylation .

SaeS has three primary enzymatic activities:

  • Autokinase activity (self-phosphorylation)

  • Phosphotransferase activity (transfer of phosphate to SaeR)

  • Phosphatase activity (dephosphorylation of SaeR)

The phosphorylation of SaeR by SaeS enables SaeR to bind to specific DNA sequences in target promoters, thereby regulating gene expression. Notably, unphosphorylated SaeR does not bind to target DNA, while phosphorylated SaeR can bind to direct repeat sequences (GTTAAN₆GTTAA) in promoters .

How is the SaeS protein structured and what are its key domains?

SaeS is a membrane-bound histidine kinase with a distinct structural organization:

DomainLocationCompositionFunction
N-terminal domainMembraneTwo transmembrane helices (TM1 and TM2) connected by a 9-amino acid extracytoplasmic linker peptide (ELP)Signal sensing and transduction
C-terminal domainCytoplasmDimerization and histidine phosphotransfer (DHp) domain and catalytic and ATP-binding (CA) domainEnzymatic activities (autokinase, phosphotransferase, phosphatase)

The extracytoplasmic linker peptide (residues 32-40) plays a critical role in controlling SaeS's basal kinase activity and response to inducing signals such as human neutrophil peptides (HNPs) . The amino acid sequence of this linker peptide is highly optimized for its function .

What signals activate the SaeS histidine kinase?

SaeS responds to various host-derived signals, particularly those related to innate immune defense:

  • Human neutrophil peptides (HNP1-3): These antimicrobial peptides show the most pronounced effect on SaeS activation . HNP1 can induce the kinase activity of SaeS, although this response varies among different S. aureus strains.

  • Membrane-targeting factors: As an intramembrane-sensing histidine kinase, SaeS can detect perturbations in the membrane environment.

  • Phagocytosis-related signals: SaeS is activated during phagocytosis, helping the bacteria respond to the hostile environment within phagocytes .

It should be noted that the widely used laboratory strains 8325 and Col have been found to be non-responsive to HNP1-3 sensing, whereas clinical isolates such as USA300 lineage strains show robust responses .

How does the extracytoplasmic linker peptide of SaeS control its kinase activity?

The 9-amino acid extracytoplasmic linker peptide (ELP) of SaeS plays a crucial role in regulating its kinase activity through a mechanism that has been compared to a "tripwire" .

Research has demonstrated that:

  • Deletion of the linker peptide: When the linker peptide is deleted, SaeS displays aberrantly elevated kinase activity even in the absence of inducing signals and does not respond to HNP1 .

  • Alanine substitution analysis: Alanine scanning mutagenesis of the linker peptide reveals its critical role:

    • W32A, N34A, G35A, and L39A mutations significantly decrease basal kinase activity

    • H36A, M37A, and T38A mutations increase basal kinase activity

    • M37A, T38A, and L39A mutations abolish response to HNP1

  • Enzymatic activity changes: Mutations in the linker peptide alter both autokinase and phosphotransferase activities of SaeS .

This evidence suggests that the linker peptide functions as a restraint that keeps SaeS's basal kinase activity at an appropriate level and enables it to respond to specific environmental signals. The amino acid sequence of the linker peptide is highly optimized, with even single amino acid substitutions capable of dramatically altering SaeS functionality .

What is the "tripwire" model of SaeS activation and how does it explain signal sensing?

The "tripwire" model proposes that the N-terminal domain of SaeS (two transmembrane helices and the extracytoplasmic linker peptide) functions as a coherent unit to detect and respond to environmental signals .

Key aspects of this model include:

This model is supported by experiments showing that replacement of the N-terminal domain of SaeS with that of another histidine kinase (GraS) results in altered basal activity and responsiveness to HNP1 .

What is the relationship between SaeS and other regulatory systems in S. aureus?

The SaeRS TCS interacts with several other regulatory systems in S. aureus to coordinate virulence gene expression:

Regulatory SystemInteraction with SaeRSEffect on Virulence
Agr quorum sensing systemAgr reduces TSST-1 expression independently of SaeCoordinated regulation of virulence
SarADeletion of sarA results in dramatic overexpression of TSST-1, but double mutation of saeS and sarA results in loss of TSST-1 expressionComplex interplay in regulating toxin production
SrrABMutation of srrAB decreases TSST-1 productionPotential cross-regulation

The SaeRS system also has a negative feedback mechanism mediated by the auxiliary proteins SaeP and SaeQ. These proteins form a complex with SaeS and activate its phosphatase activity, returning the system to its pre-activation state .

The expression of SaeP and SaeQ is induced by the SaeRS TCS itself, creating a regulatory loop:

  • Active phosphorylated SaeR induces expression of SaeP and SaeQ

  • SaeP and SaeQ form a complex with SaeS

  • This complex enhances SaeS phosphatase activity

  • SaeS dephosphorylates SaeR, reducing target gene expression

What methods can be used to measure SaeS kinase activity in vitro?

Several biochemical approaches can be employed to assess SaeS kinase activity:

  • Autokinase activity assay:

    • Mix purified MBP-SaeS fusion proteins with [γ-³²P]ATP

    • Incubate to allow autophosphorylation

    • Analyze by SDS-PAGE and autoradiography

    • Quantify phosphorylation intensity

  • Phosphotransferase activity assay:

    • Pre-phosphorylate MBP-SaeS with [γ-³²P]ATP

    • Add purified SaeR

    • Monitor phosphotransfer by SDS-PAGE and autoradiography

    • Measure decrease in SaeS phosphorylation and increase in SaeR phosphorylation

  • Reporter gene assays:

    • Use promoters with different affinities for phosphorylated SaeR (Pcoa and Phla)

    • Fuse promoters to reporter genes (e.g., GFP, luciferase)

    • Measure reporter activity as a proxy for SaeS kinase activity

  • DNase I footprinting:

    • Used to identify SaeR binding sites in target promoters

    • Requires phosphorylated SaeR (generated by active SaeS)

    • Enables visualization of protected DNA regions

Each method provides different insights into SaeS function. For comprehensive analysis, combining multiple approaches is recommended .

How can SaeS mutants be generated and what are the key considerations for mutagenesis studies?

Several approaches for generating SaeS mutants have been described in the literature:

  • Site-directed mutagenesis:

    • Particularly useful for targeting specific amino acids in the linker peptide or transmembrane domains

    • Point mutations (e.g., alanine substitutions) can reveal the importance of individual residues

    • Protocol example: Use overlapping PCR primers containing the desired mutation

  • Domain replacement:

    • Replace entire domains (e.g., N-terminal domain) with corresponding regions from other histidine kinases

    • Useful for analyzing domain-specific functions

    • Example: SaeS/GraS chimeric proteins to study domain contributions

  • Deletion mutagenesis:

    • Remove specific regions (e.g., linker peptide, transmembrane helices)

    • Reveals essential structural elements

    • Caution: May affect protein stability or membrane localization

Key considerations:

  • Protein stability: Mutations may affect protein expression levels or stability; always verify by Western blot

  • Membrane localization: For transmembrane proteins like SaeS, confirm proper localization after mutation

  • Functional readouts: Use multiple assays (reporter genes, biochemical assays) to comprehensively assess effects

  • Strain-specific differences: SaeS function varies between strains (e.g., Newman strain has constitutively active SaeS due to L18P mutation)

What reporter systems are most effective for studying SaeS activity in vivo?

Several reporter systems have been successfully employed to monitor SaeS activity:

  • Pcoa-GFP reporter:

    • The coagulase promoter is a low-affinity target of phosphorylated SaeR

    • Highly sensitive to increases in SaeS kinase activity

    • Limited ability to detect decreases in activity

    • Useful for identifying hyperactive mutants

  • Phla-GFP reporter:

    • The alpha-hemolysin promoter is a high-affinity target of phosphorylated SaeR

    • Relatively insensitive to increases in SaeS activity

    • Can detect large decreases in kinase activity

    • Useful for identifying hypoactive mutants

  • Luciferase-based reporters:

    • Provide quantitative, real-time measurement of promoter activity

    • Higher sensitivity than fluorescent reporters

    • Enable kinetic studies of SaeS activation

  • Direct measurement of target gene products:

    • Western blot for proteins like coagulase or alpha-hemolysin

    • qRT-PCR for mRNA levels

    • Functional assays (e.g., coagulation of rabbit plasma, hemolysis on blood agar)

For comprehensive analysis, researchers should employ multiple reporter systems targeting both high-affinity and low-affinity SaeR binding sites.

How does SaeS function vary between different S. aureus strains and what are the implications for virulence?

Significant strain-specific variations in SaeS function have been documented:

  • Newman strain: Contains a L18P mutation in the first transmembrane helix that renders SaeS constitutively active, resulting in hypervirulence .

  • USA300 lineage: Shows robust SaeS response to HNP1-3, contributing to its success as a community-associated MRSA strain .

  • Laboratory strains 8325 and Col: Exhibit non-responsiveness to HNP1-3 sensing, potentially affecting their virulence in specific host environments .

  • S. epidermidis SaeS homolog: Contains only one predicted transmembrane helix (versus two in S. aureus SaeS), suggesting differences in sensing mechanisms .

These variations have significant implications:

  • Virulence heterogeneity: Different strains may exhibit varied virulence profiles based on SaeS activity

  • Host adaptation: Strain-specific SaeS properties may reflect adaptation to different host niches

  • Experimental considerations: Results from one strain may not be generalizable to others

  • Therapeutic targeting: Strain variations must be considered when developing anti-virulence strategies

Research has shown that even single amino acid changes in SaeS can dramatically alter virulence factor production, underscoring the importance of strain-specific characterization .

Could SaeS be a viable target for anti-virulence therapies and what approaches might be most promising?

SaeS represents a promising target for anti-virulence strategies for several reasons:

  • Central regulatory role: SaeS controls multiple virulence factors, providing a single target to downregulate numerous virulence mechanisms .

  • Required for virulence: Research shows SaeS is essential for in vivo survival of S. aureus .

  • Unique structural features: The distinctive N-terminal domain with its critical linker peptide offers specific targeting opportunities .

Potential therapeutic approaches include:

ApproachTargetPotential MechanismAdvantages
Small molecule inhibitorsSaeS kinase activityBlock ATP binding or interfere with autophosphorylationMay not affect bacterial growth, reducing selection pressure
PeptidomimeticsExtracytoplasmic linker peptideDisrupt signal sensing or transmissionHigh specificity due to unique sequence
Allosteric modulatorsTransmembrane domainsAlter protein conformation to favor phosphatase activityCould leverage natural regulatory mechanisms
Anti-SaeR strategiesSaeR-DNA bindingPrevent transcriptional activation of virulence genesComplementary approach targeting downstream effector

Several challenges must be addressed:

  • Ensuring membrane permeability of potential inhibitors

  • Accounting for strain-specific variations in SaeS structure

  • Developing appropriate screening assays

  • Demonstrating efficacy in animal models

The "tripwire" model of SaeS activation suggests that compounds mimicking the structure of human neutrophil peptides but causing conformational changes that inhibit rather than activate SaeS could be particularly effective .

What are the most significant technical challenges in expressing and purifying recombinant SaeS for structural studies?

Expressing and purifying recombinant SaeS presents several technical challenges:

  • Membrane protein expression:

    • SaeS is an integral membrane protein with two transmembrane domains

    • Expression in conventional E. coli systems often results in inclusion bodies

    • Strategies to overcome: Use specialized E. coli strains (C41, C43), lower induction temperature, or fusion tags that enhance solubility

  • Protein stability:

    • SaeS mutants show variable stability in vivo

    • Some mutants (particularly those affecting the linker peptide) may be prone to degradation

    • Western blot analysis shows that even minor mutations can dramatically affect protein levels

  • Functional reconstitution:

    • Maintaining the native conformation of transmembrane domains during purification

    • Requires appropriate detergents or lipid environments

    • Critical for preserving enzyme activity

  • Purification strategies:

    • MBP (maltose-binding protein) fusion has been successfully used

    • His-tagged constructs can facilitate purification

    • Two-step purification protocols improve purity

  • Crystallization challenges:

    • Membrane proteins are notoriously difficult to crystallize

    • Conformational heterogeneity complicates structural determination

    • No high-resolution structure of full-length SaeS has been reported to date

Recommended approach:

  • Express as MBP-SaeS fusion protein for increased solubility

  • Use mild detergents (DDM, LMNG) for extraction from membranes

  • Consider using nanodiscs or lipid cubic phase for functional studies

  • Verify activity using in vitro kinase assays

  • For structural studies, consider domain-based approaches focusing on the cytoplasmic portion

How might the SaeS "tripwire" mechanism apply to other intramembrane-sensing histidine kinases?

The "tripwire" mechanism identified in SaeS potentially represents a broadly applicable model for other intramembrane-sensing histidine kinases (IM-HKs):

  • Conserved features across IM-HKs:

    • S. aureus contains four IM-HKs: SaeS, VraS, GraS, and BraS

    • These kinases lack conventional extracellular sensing domains

    • Instead, they use their transmembrane regions and short extracytoplasmic linkers for signal detection

  • Comparative analysis of extracytoplasmic linker peptides:

    IM-HKLinker LengthKnown SignalsSensitivity to Membrane Perturbation
    SaeS9 amino acidsHNP1-3High
    GraSVariable (strain-dependent)CAMPs, low pHModerate
    VraSShortCell wall stressHigh
    BraSShortBacitracinModerate
  • Evolutionary implications:

    • The highly optimized linker sequence of SaeS suggests selective pressure

    • Different IM-HKs may have evolved specialized sensing capacities through linker specialization

    • The simple architecture may represent an efficient solution for detecting specific membrane-associated signals

  • Research directions:

    • Comparative mutagenesis of linker peptides across different IM-HKs

    • Domain swapping experiments between related IM-HKs

    • Investigation of how specific signals interact with different linker sequences

    • Molecular dynamics simulations to understand conformational changes

Understanding the shared and unique aspects of signal sensing across IM-HKs could provide valuable insights for developing targeted anti-virulence strategies against multiple bacterial pathogens .

What is the molecular basis for the differential effect of SaeP/SaeQ on high versus low affinity SaeR targets?

The SaeP and SaeQ auxiliary proteins have been shown to have differential effects on SaeR target genes with different affinities for phosphorylated SaeR:

Understanding this differential regulation could provide insights into the temporal dynamics of virulence factor expression during infection and potentially identify novel intervention points.

What biochemical and structural approaches could help resolve the precise signal sensing mechanism of SaeS?

Elucidating the precise signal sensing mechanism of SaeS would require integration of multiple advanced biochemical and structural approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Ideal for membrane proteins resistant to crystallization

    • Could capture different conformational states (inactive vs. active)

    • Challenges: Protein size (SaeS is relatively small), conformational heterogeneity

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry):

    • Maps conformational changes upon signal binding

    • Could identify regions with altered solvent accessibility when exposed to HNP1

    • Provides dynamic structural information without crystallization

  • FRET-based conformational sensors:

    • Engineer SaeS variants with fluorophores in strategic positions

    • Monitor real-time conformational changes upon signal exposure

    • Can detect subtle structural alterations in native-like environments

  • Molecular dynamics simulations:

    • Model interactions between SaeS transmembrane domains, linker peptide, and membrane

    • Simulate effects of HNP1 binding

    • Predict conformational changes that transmit signals to the cytoplasmic domain

  • Cross-linking mass spectrometry:

    • Identify interaction surfaces between SaeS domains or with signaling molecules

    • Map proximity relationships in different activation states

    • Combined with structural modeling to generate comprehensive interaction maps

  • Reconstitution in defined membrane systems:

    • Nanodiscs or liposomes with controlled lipid composition

    • Test membrane composition effects on signal sensitivity

    • Allow controlled introduction of potential signaling molecules

  • NMR studies of isolated domains:

    • Solution NMR of the cytoplasmic domain to detect conformational changes

    • Solid-state NMR of transmembrane regions in membrane mimetics

    • Identify dynamic changes upon signal binding

An integrated approach combining these methods would provide complementary insights into how SaeS detects and responds to host-derived signals, potentially revealing novel mechanisms of membrane-associated signal transduction that could be exploited therapeutically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.