Recombinant Staphylococcus aureus Holin-like protein CidB (cidB)

Shipped with Ice Packs
In Stock

Description

Biofilm Development and Cell Lysis

  • The cidABC operon promotes murein hydrolase activity, enhancing cell lysis and extracellular DNA (eDNA) release, which stabilizes biofilm matrices .

  • CidB’s exact role remains less characterized than CidA (holin) or CidC (pyruvate oxidase), but studies suggest it contributes to cell death under specific regulatory conditions. For example, in S. aureus strains lacking the SrrAB two-component system, CidB is essential for glucose-induced cell death .

Metabolite Transport

  • CidB and LrgA homologues facilitate pyruvate uptake during anaerobic growth, linking holin-like activity to metabolic regulation .

  • This dual functionality—mediating cell lysis and metabolite transport—suggests a broader role in stress adaptation and resource utilization .

Research Findings and Experimental Insights

  • Holin-like Activity:

    • CidA and LrgA form membrane pores enabling small-molecule leakage, a hallmark of holin function. While CidB’s pore-forming capacity is unconfirmed, its genetic linkage to cidA implies cooperative roles .

    • In a cidA cysteine mutant, disrupted oligomerization increased cell lysis and biofilm adhesion, highlighting the importance of structural stability .

  • Regulatory Dependencies:

    • cidABC transcription is CidR-dependent and induced by acetic acid, a by-product of CidC-mediated pyruvate metabolism .

    • Disruption of alsSD (acetoin synthesis genes) abolishes cidABC and lrgAB induction, indicating metabolic cross-talk .

Applications in Biomedical Research

  • Vaccine Development: Recombinant CidB is used to study immune responses against S. aureus biofilms and explore subunit vaccine candidates .

  • Antibiotic Adjuvant Research: Modulating CidB activity could enhance penicillin sensitivity by regulating murein hydrolase release .

Challenges and Future Directions

  • Mechanistic Clarification: The precise biochemical role of CidB in holin complexes or metabolite transport requires further structural and functional studies.

  • Therapeutic Targeting: Inhibiting CidB could destabilize biofilms or sensitize S. aureus to antibiotics, but off-target effects on metabolism must be evaluated .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the specific delivery timeframe.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Typically, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
cidB; SAV2540; Holin-like protein CidB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
cidB
Target Protein Sequence
MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY
Uniprot No.

Target Background

Function
CidB, a holin-like protein from Staphylococcus aureus, enhances the activity of extracellular murein hydrolases potentially by facilitating their export through pore formation. It is inhibited by the antiholin-like proteins LrgAB. In unstressed cells, LrgAB products likely inhibit the function of CidAB proteins. When a cell experiences stress, such as antibiotic exposure or other environmental factors, CidAB proteins may oligomerize within the bacterial cell membrane, creating lesions that disrupt the proton motive force, leading to loss of cell viability. These lesions are also hypothesized to regulate subsequent cell lysis by either granting murein hydrolases access to the cell wall substrate or regulating their activity through a potential alteration in cell wall pH caused by membrane potential loss.
Database Links

KEGG: sav:SAV2540

STRING: 158878.SAV2540

Protein Families
CidB/LrgB family, CidB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus aureus CidB and what is its primary function?

Staphylococcus aureus CidB is a membrane-associated protein encoded by the cidB gene within the cidABC operon. It functions as a holin-like protein that works in conjunction with CidA to control cell death and lysis during biofilm development . The full-length protein consists of 229 amino acids with multiple transmembrane domains and has been identified as the functional counterpart to the antiholin-like LrgAB system .

CidB is part of a well-conserved family of proteins involved in programmed cell death (PCD) in bacteria. Based on structural similarities to bacteriophage holins, CidB is believed to participate in forming pores within the cytoplasmic membrane, facilitating the transport of murein hydrolases and small metabolic by-products .

What is the relationship between CidB and the cidABC operon?

The cidB gene is the second gene in the cidABC operon. Interestingly, transcriptional analysis has revealed two distinct transcripts from this operon:

  • A complete transcript spanning all three genes (cidA, cidB, and cidC) that is induced by growth in the presence of acetic acid

  • A shorter transcript spanning only cidB and cidC that is produced in a sigma B-dependent manner

The cidABC operon lies immediately downstream from the cidR gene, which encodes a LysR-type transcriptional regulator that positively regulates cidABC expression, particularly in response to acetic acid accumulation resulting from glucose metabolism . This regulatory mechanism connects CidB function to central metabolism and stress responses in S. aureus.

How does CidB contribute to S. aureus programmed cell death and antibiotic tolerance?

CidB works in concert with CidA to form a functional holin-like system that increases extracellular murein hydrolase activity and enhances sensitivity to antibiotics, particularly penicillin . Experimental evidence supports that the cidAB operon acts in a manner opposite to the lrgAB operon, which inhibits murein hydrolase activity and increases antibiotic tolerance .

Mechanistically, CidB appears to be involved in creating membrane pores that facilitate the transport of murein hydrolases to the cell wall, promoting cell lysis under specific conditions. This function has been demonstrated through several experimental approaches:

  • Mutation studies showing decreased extracellular murein hydrolase activity in cidA mutants

  • Complementation experiments restoring wild-type phenotypes

  • "Lysis cassette" systems demonstrating the ability of cidA and lrgA genes to support bacteriophage endolysin-induced cell lysis

  • Membrane vesicle experiments showing localization to membrane surfaces and causing leakage of small molecules

These findings collectively establish CidB as part of a bacterial control system for cell death and lysis that impacts antibiotic effectiveness.

What is known about CidB membrane topology and oligomerization properties?

Similar to CidA, CidB is a membrane-associated protein with multiple transmembrane domains. Research has shown that these proteins can oligomerize into high-molecular-mass complexes, a property critical to their function . This oligomerization is dependent on disulfide bonds formed between cysteine residues, similar to the mechanism observed in bacteriophage holins .

Methodological approaches to study CidB topology and oligomerization include:

  • Membrane fractionation studies

  • Fluorescent protein fusion techniques

  • Size exclusion chromatography to analyze complex formation

  • Disulfide bond mapping through cysteine mutagenesis

Research has demonstrated that disrupting the ability of these proteins to form disulfide-dependent oligomers significantly impacts their function. This provides strong evidence that, like holins, CidB's biological activity depends on its ability to form higher-order structures within the membrane .

What experimental designs are most appropriate for investigating CidB function?

When investigating CidB function, researchers should consider true experimental designs with appropriate controls. Based on established research methodologies, the following experimental approach is recommended:

  • Define clear research questions and hypotheses

    • Identify specific aspects of CidB function to investigate

    • Formulate testable hypotheses about CidB's role in cell death, membrane permeability, or antibiotic tolerance

  • Variable identification and control

    • Independent variables: CidB expression levels, mutations in specific domains

    • Dependent variables: Membrane permeability, cell viability, antibiotic sensitivity

    • Control for extraneous variables: Growth conditions, genetic background

  • Experimental treatments

    • Wild-type vs. cidB knockout strains

    • Complementation with various cidB constructs

    • Domain-specific mutations to test structure-function relationships

  • Data collection approaches

    • Quantitative murein hydrolase activity assays

    • Membrane permeability measurements

    • Cell death and antibiotic tolerance assays

    • Protein-protein interaction studies

How does CidB interact with bacterial metabolic pathways?

While CidB itself has not been directly implicated in metabolic regulation, the cidABC operon is functionally connected to metabolism through both regulation and the activity of CidC. The cidC gene encodes a pyruvate oxidase that catalyzes the oxidative decarboxylation of pyruvate, yielding acetate and CO₂ .

This metabolic connection is significant because:

  • The cidABC operon is induced by acetic acid generated during aerobic growth with excess glucose

  • CidC contributes to acetic acid production, which affects cell death and lysis in stationary phase

  • The CidA and LrgA proteins have been shown to facilitate the transport of small by-products of carbohydrate metabolism

Experimental evidence indicates that CidA and LrgA homologs in other bacterial and plant species are involved in pyruvate transport, particularly during microaerobic and anaerobic growth . This suggests a broader role for the Cid/Lrg system in metabolic adaptation beyond cell death control.

How should researchers address contradictory findings about CidB function?

When confronted with contradictory data regarding CidB function, researchers should apply a structured approach to resolving discrepancies:

  • Systematic analysis of experimental variables

    • Compare growth conditions, strain backgrounds, and experimental methodologies

    • Identify potential confounding variables that might explain differences

  • Classify contradiction types

    • Assess whether contradictions are intra-study (within the same study) or inter-study (between different studies)

    • Determine if contradictions are related to content/results or methodological approaches

  • Design experiments specifically to address contradictions

    • Create controlled experiments where only one variable differs at a time

    • Include positive and negative controls to validate experimental systems

  • Consider scope and appearance of contradictions

    • Evaluate whether contradictions are local (related to specific aspects) or global (fundamental differences in understanding)

    • Determine if the contradictions reflect different aspects of a complex biological system rather than true inconsistencies

A notable example in CidB research is the seemingly contradictory findings regarding its role in antibiotic tolerance. While cidA mutations decreased sensitivity to penicillin, complementation of the cidA defect did not fully restore wild-type sensitivity levels . This apparent contradiction suggests complex regulatory mechanisms that require careful experimental design to unravel.

What methodological approaches are recommended for studying CidB structure-function relationships?

Investigating the structure-function relationships of membrane proteins like CidB requires specialized approaches:

  • Site-directed mutagenesis strategies

    • Target conserved residues in transmembrane domains

    • Create systematic alanine scanning mutants to identify critical regions

    • Focus on cysteine residues involved in disulfide-dependent oligomerization

  • Membrane topology mapping

    • Use reporter fusion proteins (e.g., GFP, PhoA) to determine membrane orientation

    • Apply cysteine accessibility methods to probe membrane-spanning regions

    • Combine computational prediction with experimental validation

  • Functional complementation assays

    • Test ability of mutant constructs to restore wild-type phenotypes in cidB knockout strains

    • Assess cross-complementation with homologs from other bacterial species

    • Evaluate domain swapping with related proteins (e.g., CidA, LrgA)

  • Protein-protein interaction studies

    • Investigate interactions between CidB and other Cid/Lrg proteins

    • Identify potential regulatory partners using co-immunoprecipitation

    • Apply bacterial two-hybrid systems adapted for membrane proteins

These methodological approaches should be combined with functional assays measuring murein hydrolase activity, membrane permeability, and antibiotic tolerance to establish clear structure-function relationships.

How does CidB contribute to S. aureus biofilm development and antibiotic resistance?

CidB plays a significant role in biofilm development through its involvement in controlled cell death and lysis. Research has established that the Cid/Lrg system regulates:

  • The release of extracellular DNA (eDNA) during biofilm formation

  • Cell lysis processes that contribute to biofilm matrix development

  • Metabolic adaptation within biofilm microenvironments

Specifically, CidA and LrgA proteins have been shown to function as holin-like proteins that control cell death and lysis during biofilm development . This regulated cell death contributes to the structural integrity and antibiotic resistance of S. aureus biofilms.

Experimental methodologies to study CidB's role in biofilms include:

  • Static and flow cell biofilm formation assays

  • Confocal microscopy with fluorescent reporters

  • eDNA quantification techniques

  • Antibiotic susceptibility testing in biofilm vs. planktonic conditions

Understanding CidB's contribution to biofilm development may provide new targets for therapeutic intervention against S. aureus infections, particularly those involving antibiotic-resistant biofilms.

What regulatory factors control cidB expression and how can they be experimentally manipulated?

The expression of cidB is subject to complex regulatory control mechanisms that can be experimentally manipulated to study protein function:

  • Transcriptional regulation by CidR

    • The cidR gene encodes a LysR-type transcriptional regulator that positively regulates cidABC expression

    • CidR increases cidABC transcription specifically in response to acetic acid accumulation

    • Experimental approach: Use cidR mutants or controlled expression systems to modulate cidB expression

  • Growth phase-dependent regulation

    • The cidAB operon is maximally expressed during early exponential growth, opposite to lrgAB expression

    • Experimental approach: Synchronize cultures and sample at defined growth phases

  • Metabolic regulation

    • Acetic acid produced from glucose metabolism induces the complete cidABC transcript

    • Sigma B-dependent regulation controls the shorter cidBC transcript

    • Experimental approach: Manipulate growth media composition and monitor expression

  • Experimental control systems

    • Inducible promoter systems (e.g., tetracycline-inducible) to control expression timing and levels

    • Integration of reporter constructs (e.g., lacZ fusions) to monitor transcriptional activity

    • Use of defined genetic backgrounds to eliminate confounding regulatory factors

By manipulating these regulatory systems, researchers can create experimental conditions that allow precise control over CidB expression for functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.