Recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus MscL

The recombinant Staphylococcus aureus Large-conductance mechanosensitive channel (MscL) is a bioengineered protein expressed in E. coli for research purposes. It represents a critical tool for studying bacterial mechanosensation, antimicrobial resistance, and membrane biophysics. This protein is His-tagged for purification and maintains structural and functional fidelity to its native form, enabling detailed analysis of its gating mechanisms and interactions with membrane tension .

2.1. Oligomeric State and Architecture

MscL forms pentameric assemblies in vivo, as confirmed by disulfide-trapping experiments and sedimentation equilibrium centrifugation . Its structure includes:

  • Two transmembrane helices (TM1 and TM2) that form a pore-lining pathway.

  • Amphipathic N-terminal helices critical for channel gating .

  • Periplasmic loops that interact with membrane lipids to sense mechanical stress .

ParameterValueSource
Oligomeric StatePentamer (in vivo)
Subunit Length120 amino acids (1–120)
UniProt IDQ2YXW9 (RFL28267SF), A5ISN0 (RFL16438SF)
Purity>90% (SDS-PAGE)

2.2. Functional Mechanism

MscL acts as an emergency release valve, opening under high membrane tension to prevent osmotic lysis. Key findings include:

  • Critical Adhesion Forces: Parent S. aureus strains exhibit calcein uptake at >4.0 nN adhesion force, while ΔmscL mutants show reduced transport (<1.2 nN) .

  • Antibiotic Uptake: Dihydrostreptomycin efficacy is MscL-dependent, with a 2.3 log-unit CFU reduction in parent strains vs. 1.0 log-unit in mutants .

3.1. Role in Mechanosensitive Gating

Adhesion forces to surfaces directly influence MscL gating by deforming the bacterial cell wall and membrane. This triggers lipid density changes, altering membrane tension and activating the channel .

MetricParent StrainΔmscL MutantCritical Force
Calcein Uptake (%)66404.0 nN vs. 1.2 nN
Dihydrostreptomycin Efficacy (log CFU reduction)2.31.0>3.5 nN

3.2. Modulation by Compounds

Small molecules like SCH-79797 and curcumin activate MscL, increasing membrane permeabilization and bacterial susceptibility to antibiotics . These compounds bind to the N-terminal/TM2 interface, lowering the gating threshold .

4.1. Recombinant Protein Details

Key parameters for RFL28267SF and RFL16438SF variants:

AttributeValue
Expression HostE. coli
His-Tag LocationN-terminal
Storage BufferTris/PBS, 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water
StabilityAvoid repeated freeze-thaw cycles

Future Directions and Challenges

  • Therapeutic Targets: MscL’s absence in eukaryotes makes it a candidate for antimicrobial development, though off-target effects (e.g., ramizol) require further study .

  • Structural Elucidation: High-resolution structures of the open state remain elusive, necessitating advanced cryo-EM or crystallography .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; SaurJH9_1409; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Staphylococcus aureus (strain JH9)
Target Names
mscL
Target Protein Sequence
MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWG IKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces within the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Staphylococcus aureus MscL?

S. aureus MscL exists as a pentamer in the cell membrane, as confirmed through multiple biophysical techniques including equilibrium sedimentation centrifugation and size-exclusion chromatography with multi-angle light scattering (SEC-MALS). When purified in the neutrally buoyant detergent C8E5, SaMscL demonstrates a calculated protein mass of approximately 71.2 kDa, which closely aligns with the theoretical pentamer mass of 72.2 kDa . This pentameric arrangement is similar to MscL channels found in other bacterial species, though with notable species-specific structural differences.

What is the physiological function of MscL in Staphylococcus aureus?

The primary physiological role of MscL in S. aureus, like in other bacteria, is to serve as an emergency release valve that discharges cytoplasmic solutes upon experiencing osmotic stress . This function is crucial for bacterial survival during rapid environmental changes, particularly hypoosmotic shock, which could otherwise lead to cell lysis.

Unlike many other membrane transport proteins, MscL does not require an energy source or metabolic activity to function; it only needs an appropriate stimulus, which typically comes in the form of membrane tension . This characteristic enables MscL to remain functional even in stationary or dormant bacterial cells, making it a potential target for addressing difficult-to-treat infections like S. aureus biofilms .

The expression of MscL occurs throughout all phases of bacterial growth and is notably upregulated in stationary phase cells . This expression pattern further underscores its importance in bacterial stress responses across various growth conditions.

How does the mechanism of MscL gating differ between S. aureus and other bacterial species?

The MscL channel gating mechanism demonstrates significant conservation across bacterial species, though with notable differences in activation thresholds and kinetics. In comparative studies between bacteria, researchers have observed that while the basic function of MscL as a pressure-relief valve is preserved, the specific biophysical properties can vary considerably.

For instance, in Escherichia coli, MscL requires approximately 1.8 times more suction to gate compared to another mechanosensitive channel, YggB (also known as MscS) . This higher activation threshold suggests different roles for these channels during osmotic stress responses. For S. aureus MscL specifically, the channel demonstrates distinctive gating properties that reflect its adaptation to the unique cell wall characteristics and environmental pressures faced by this pathogen.

Patch clamp studies have revealed that despite structural conservation of the mscL gene across bacterial species, the channels exhibit species-specific sensitivity to membrane tension. These differences may be attributed to variations in the transmembrane domains and the channel's interaction with the surrounding lipid environment .

How do compounds like 011A and xanthorrhizol interact with SaMscL at the molecular level?

Compounds that target MscL, such as 011A and xanthorrhizol, appear to induce channel opening by interacting with specific residues within the channel structure. The molecular mechanisms involve:

  • 011A Interaction with SaMscL: This compound binds to SaMscL and promotes channel opening, effectively creating a "leaky" bacterial membrane. Experimental evidence shows that 011A treatment results in decreased growth of wild-type S. aureus but not MscL-null strains, confirming its specificity for the channel . The compound is believed to stabilize the open state of the channel, possibly by interacting with hydrophobic residues in the constriction region.

  • Xanthorrhizol Mechanism: This natural antimicrobial agent targets SaMscL through a similar mechanism. Morphological studies using refractive index tomography have shown that xanthorrhizol treatment causes characteristic changes in S. aureus cells consistent with spontaneous MscL activation, including decreased cell volume, cytoplasm concentration, and cellular dry mass . Time-kill assays demonstrated that wild-type S. aureus cells are significantly more susceptible to xanthorrhizol than ΔmscL mutants, with a difference of up to 2 orders of magnitude in survival after brief exposure .

Site-directed mutagenesis studies involving substitutions in key regions of SaMscL (E4C, F5C, F8C, V14C, M23C, F73C, A77C, F78C, A79C, V84C, and F85C) have provided insights into the specific residues involved in compound binding and channel gating . These studies help elucidate the structural basis for the selective antimicrobial activity of these compounds.

What is the potential of SaMscL as an antibiotic target, and what are the current limitations?

SaMscL presents a promising novel target for antibiotic development based on several advantageous characteristics:

  • Broad Conservation: The mscL gene is highly conserved and present in the vast majority of bacterial species, including numerous pathogens, suggesting that MscL-targeting compounds could potentially function as broad-spectrum antibiotics .

  • Activity Against Dormant Cells: Unlike many conventional antibiotics that target active cellular processes, MscL activators can affect stationary phase or dormant cells. This is particularly relevant for chronic S. aureus infections and biofilms, which are notoriously difficult to treat with standard antibiotics .

  • Adjuvant Potential: Compounds that activate MscL can increase the potency of other antibiotics by permeabilizing the bacterial membrane, allowing easier access of the antibiotic to its intracellular targets .

  • Selectivity Issues: Developing compounds that specifically target bacterial MscL without affecting host cells remains challenging.

  • Resistance Development: Although less likely than with traditional antibiotic targets, bacteria might potentially develop resistance through mutations in the mscL gene or compensatory mechanisms.

  • Variability in Efficacy: The effectiveness of MscL activators may vary across bacterial species due to structural differences in the channel or cell envelope composition, as seen in comparative studies between S. aureus and M. smegmatis .

What are the recommended protocols for recombinant expression and purification of S. aureus MscL?

Recombinant Expression System:

For optimal expression of recombinant S. aureus MscL, researchers typically utilize the following approach:

  • Vector Construction: A protein expression vector suitable for S. aureus, such as pBEP (derived from the B. subtilis/E. coli shuttle vector pBE-S), can be constructed with an IPTG-inducible Pgrac promoter .

  • Gene Amplification: The mscL gene should be amplified from S. aureus genomic DNA (e.g., ATCC 29213 strain) using appropriate primers. For instance:

    • Forward primer (mL5): 5′-CAATTAAAGGAGGAAGGATCCATGTTAAAAGAATTCAAAGAG-3′

    • Reverse primer (mL6): 5′-GATGTCTAGACTGCAGGTCGACTTTTTTCTCACGTAATAAATC-3′

  • Construct Design: The amplified gene is inserted into the BamHI/SalI sites of the expression vector, in-frame with a C-terminal 6x-histidine tag for purification purposes.

  • Host Selection: While E. coli is commonly used for heterologous expression, expression in S. aureus itself (particularly in MscL-null strains) can be advantageous for functional studies .

  • Induction Conditions: Expression is typically induced with 1 mM IPTG for 1-3 hours at 37°C, though temperature and duration may require optimization.

Purification Protocol:

  • Cell Lysis: Cells are harvested and disrupted by sonication or French press in a buffer containing 50 mM phosphate pH 7.5, 300 mM NaCl, and protease inhibitors.

  • Membrane Fraction Isolation: The membrane fraction is isolated by ultracentrifugation and solubilized in an appropriate detergent, with C8E5 preferred for maintaining the native pentameric structure .

  • Affinity Chromatography: The His-tagged protein is purified using Ni-NTA affinity chromatography.

  • Size Exclusion Chromatography: Further purification by size exclusion chromatography helps eliminate aggregates and ensure homogeneity.

  • Quality Control: Protein purity should be assessed by SDS-PAGE and Western blotting using anti-histidine antibodies. The oligomeric state can be verified using SEC-MALS or analytical ultracentrifugation .

What methods are most effective for assessing MscL function in S. aureus?

Several complementary methods are available for evaluating MscL function in S. aureus:

Growth Inhibition Assays:

Growth inhibition assays provide a straightforward approach to assess MscL activator effects on bacterial growth. The protocol involves:

  • Preparing overnight cultures of wild-type and ΔmscL S. aureus strains.

  • Diluting cultures 400-fold in fresh medium and incubating for 1.5 hours at 37°C.

  • Adding 1 μL of cell suspension to 99 μL of compound-enriched medium in 96-well plates.

  • Monitoring optical density (OD600) every 10 minutes for 16 hours using a microplate reader .

The effectiveness of MscL-targeting compounds is confirmed by comparing growth inhibition between wild-type and MscL-null strains, with genuine MscL activators showing significantly greater inhibition of wild-type cells.

Viability Assays for Stationary Phase Cells:

To assess the effect on dormant or stationary phase cells:

  • Grow cultures to stationary phase (typically 16-24 hours).

  • Expose cells to the test compound at appropriate concentrations.

  • At designated time points (e.g., 6 hours post-treatment), prepare serial dilutions and plate on solid media.

  • Count colony-forming units (CFUs) after incubation .

This approach is particularly valuable for evaluating compounds that might be effective against biofilms or persistent infections.

Morphological Analysis:

Refractive index tomography provides detailed insights into the morphological changes caused by MscL activation:

  • Treat cells with the compound of interest for specified time periods.

  • Capture and analyze refractive index tomography images.

  • Quantify parameters including mean refractive index, cytoplasm concentration, cell volume, and cellular dry mass .

These measurements can reveal characteristic changes associated with MscL activation, such as decreased cell volume and cytoplasm concentration due to solute loss.

Electrophysiological Measurements:

For direct functional assessment of channel activity:

  • Prepare giant spheroplasts or reconstitute purified SaMscL into liposomes.

  • Perform patch-clamp recordings to measure channel currents.

  • Apply negative pressure to activate the channel and observe conductance.

  • Test the effect of compounds by adding them to the bath solution and measuring changes in channel gating properties.

This method provides the most direct evidence of channel function but requires specialized equipment and expertise.

How can one effectively design site-directed mutagenesis experiments to study SaMscL structure-function relationships?

Effective site-directed mutagenesis experiments for SaMscL structure-function studies require careful planning and execution:

Strategic Selection of Residues for Mutation:

  • Transmembrane Domains: Focus on residues in the pore-lining helices (M1) and the constriction region, particularly those facing the channel pore.

  • Cytoplasmic and Periplasmic Regions: Mutations in the N-terminal (S1) and C-terminal regions can provide insights into domain movement during gating.

  • Conserved Residues: Prioritize highly conserved residues identified through sequence alignment across bacterial species.

  • Based on Known Structures: Utilize available structural data from homologous MscL channels to identify functionally important regions.

Types of Mutations to Consider:

  • Cysteine Substitutions: Particularly useful for subsequent labeling experiments or disulfide crosslinking. Examples from published work include E4C, F5C, F8C, V14C, M23C, F73C, A77C, F78C, A79C, V84C, and F85C mutations in SaMscL .

  • Charge Alterations: Substituting charged residues can significantly affect channel gating properties.

  • Hydrophobicity Changes: Altering the hydrophobicity of pore-lining residues can provide insights into the energetics of channel opening.

  • Size Changes: Substituting residues with ones of different sizes can reveal spatial constraints in the channel structure.

Methodological Approach:

  • PCR-Based Methods: Employ overlap extension PCR or commercial site-directed mutagenesis kits, such as the QuickChange II-E Kit . Design primers with the desired mutations, ensuring they contain 15-20 complementary nucleotides on each side of the mutation.

  • Validation: Confirm all mutations by DNA sequencing before expression.

  • Expression Systems: Express mutant proteins in MscL-null strains to avoid interference from native channels.

  • Functional Characterization: Compare the properties of mutant channels to wild-type using:

    • Growth inhibition assays with MscL activators

    • Patch-clamp analysis of channel gating

    • Osmotic downshock survival assays

    • Fluorescence-based ion flux assays in reconstituted systems

  • Structural Analysis: When possible, combine functional studies with structural analysis using techniques such as cryo-electron microscopy or X-ray crystallography to directly observe the effects of mutations on channel structure.

How should researchers interpret discrepancies in SaMscL experimental results across different methodologies?

When encountering discrepancies in experimental results for SaMscL across different methodologies, researchers should consider several factors:

Detergent Effects on Channel Structure:

The choice of detergent can significantly impact the oligomeric state and function of SaMscL. As demonstrated in the literature, SaMscL exhibits a detergent-dependent stoichiometry, appearing as a pentamer in C8E5 but as a tetramer in LDAO . When interpreting conflicting results, researchers should:

  • Carefully document and compare the detergents used across studies

  • Consider repeating critical experiments using multiple detergent conditions

  • Evaluate whether observed functional differences correlate with changes in oligomeric state

Strain-Specific Variations:

Different S. aureus strains may exhibit variations in MscL expression, regulation, or even sequence. The table below illustrates hypothetical differences in MscL activity across common laboratory strains:

S. aureus StrainMscL Expression LevelResponse to 011AResponse to XanthorrhizolNotes
ATCC 29213+++Strong inhibitionStrong inhibitionWild-type reference strain
ATCC 29213ΔmscL-Minimal effectMinimal effectmscL null mutant
NCTC 8325++Moderate inhibitionNot testedCommon laboratory strain
USA300 (MRSA)+++Not testedStrong inhibitionClinical isolate

When comparing results across studies, strain differences should be explicitly considered as a potential source of variation.

Experimental Condition Variations:

Differences in growth conditions, media composition, and physiological state of cells can all affect MscL expression and function. For instance:

  • Growth Phase: MscL is upregulated in stationary phase compared to exponential growth

  • Osmolarity: Pre-exposure to high osmolarity may affect subsequent responses to MscL activators

  • Temperature: May influence membrane fluidity and thus MscL gating sensitivity

Reconciliation Strategies:

  • Perform side-by-side comparisons using standardized protocols

  • Utilize multiple complementary techniques to assess MscL function

  • Consider developing a consensus protocol for SaMscL studies to facilitate cross-laboratory comparisons

  • When publishing, clearly detail all experimental conditions that might affect MscL behavior

What statistical approaches are most appropriate for analyzing SaMscL functional data?

The analysis of SaMscL functional data requires appropriate statistical methods tailored to the specific experimental approach:

For Growth Inhibition and Viability Assays:

  • Repeated Measures Analysis: When tracking bacterial growth over time in the presence of MscL activators, repeated measures ANOVA or mixed-effects models are appropriate to account for the non-independence of time-series measurements.

  • Area Under the Curve (AUC) Analysis: Converting growth curves to AUC values allows for simplified comparison between conditions using t-tests or ANOVA.

  • Survival Analysis: For time-kill assays, consider using survival analysis methods that account for the time-dependent nature of bacterial death.

For Patch-Clamp Electrophysiology:

  • Non-parametric Tests: Single-channel recordings often violate normality assumptions, making non-parametric tests (e.g., Mann-Whitney U test) appropriate for comparing open probability or conductance.

  • Dwell-Time Analysis: Exponential fitting of closed and open dwell-time histograms requires maximum likelihood estimation rather than least-squares fitting.

  • Bootstrap Methods: For limited sample sizes, bootstrap approaches can provide more robust confidence intervals for channel parameters.

Sample Size and Power Considerations:

The table below provides guidance on minimum sample sizes for different types of SaMscL experiments:

Experiment TypeRecommended Minimum Sample SizePower Calculation AssumptionsNotes
Growth curvesn=6 biological replicatesEffect size d=1.5, α=0.05, power=0.8Higher replication needed for subtle phenotypes
Cell viability assaysn=3 biological replicates with 3 technical replicates eachEffect size d=2.0, α=0.05, power=0.8Logarithmic transformation of CFU data typically required
Patch-clamp recordingsn=5-10 independent patchesEffect size d=1.8, α=0.05, power=0.8Single-channel analysis may require >100 gating events
Morphological analysisn=10-12 cells per conditionEffect size d=1.2, α=0.05, power=0.8As used in published SaMscL studies

Reporting Recommendations:

  • Always report both statistical significance (p-values) and effect sizes

  • Provide clear descriptions of statistical tests used and their justification

  • When appropriate, use confidence intervals rather than p-values alone

  • For complex datasets, consider sharing raw data in public repositories

What are the most promising approaches for developing new MscL-targeting antimicrobials?

Based on current understanding of SaMscL structure and function, several promising approaches for developing new MscL-targeting antimicrobials emerge:

Rational Drug Design Based on Structural Insights:

With the elucidation of the SaMscL structure and its gating mechanism, structure-based drug design approaches become feasible:

  • In silico Screening: Molecular docking studies targeting specific regions of the channel, particularly the pore-lining helices and constriction zone.

  • Fragment-Based Drug Discovery: Identifying small molecular fragments that bind to SaMscL and then optimizing these into lead compounds.

  • Peptide Mimetics: Designing peptides that mimic structural elements involved in channel gating to stabilize the open conformation.

Combination Therapy Approaches:

The data showing that MscL activators can function as adjuvants to increase the potency of conventional antibiotics suggests promising combination strategies:

  • Dual-Action Formulations: Developing formulations containing both an MscL activator (like 011A or xanthorrhizol) and a conventional antibiotic (like tetracycline) .

  • Sequential Treatment Protocols: Administering an MscL activator to compromise bacterial membrane integrity, followed by an antibiotic that normally has limited penetration.

  • Biofilm Disruption: Using MscL activators specifically to target dormant cells in biofilms, in combination with antibiotics targeting actively dividing cells.

Natural Product Exploration:

The effectiveness of the natural product xanthorrhizol suggests that other plant-derived compounds may target MscL:

  • Screening Plant Extracts: Systematic screening of plant extracts, particularly from species used in traditional medicine for treating infections.

  • Structural Optimization: Using xanthorrhizol as a lead compound for synthetic derivatization to improve potency and specificity.

  • Ethnopharmacological Approaches: Investigating traditional remedies with documented antibacterial effects for potential MscL-targeting activity.

How might research on SaMscL contribute to understanding antibiotic resistance mechanisms?

Research on SaMscL offers several avenues for understanding and potentially overcoming antibiotic resistance:

Novel Therapeutic Target Outside Traditional Pathways:

MscL represents a target distinct from those of conventional antibiotics:

  • Reduced Cross-Resistance: Since MscL is not targeted by current antibiotics, resistant strains are unlikely to have pre-existing resistance mechanisms against MscL activators.

  • Evolutionary Constraints: The essential role of MscL in osmotic protection may constrain the development of resistance mutations that significantly alter channel function.

  • Combination Effects: Understanding how MscL activation enhances antibiotic efficacy may reveal synergistic mechanisms that can overcome existing resistance.

Mechanisms of Membrane Permeability Barriers:

MscL research provides insights into bacterial membrane permeability, a key factor in intrinsic resistance:

  • Cell Envelope Composition: Studies comparing MscL function across different bacterial species can illuminate how variations in cell envelope structure contribute to differential antibiotic susceptibility.

  • Membrane Adaptation: Investigating how bacteria adapt their membranes in response to MscL activation may reveal mechanisms relevant to resistance against membrane-active antibiotics.

  • Biofilm Penetration: Understanding how MscL activators affect dormant cells in biofilms could help address this particularly challenging form of antibiotic tolerance.

Potential for Evolution of Resistance to MscL Activators:

Exploring how bacteria might develop resistance to MscL activators provides proactive understanding of resistance mechanisms:

  • Directed Evolution Studies: Laboratory evolution experiments exposing S. aureus to sub-lethal concentrations of MscL activators could reveal potential resistance pathways.

  • Compensatory Mechanisms: Identifying mechanisms by which bacteria might compensate for persistent MscL activation could highlight new targets for combination therapy.

  • Cross-Resistance Profiling: Determining whether resistance to one MscL activator confers resistance to others would inform strategic use of these compounds.

What are the key considerations for researchers new to working with SaMscL?

For researchers beginning work with Staphylococcus aureus MscL, several key considerations should guide experimental design and interpretation:

  • Oligomeric State Variability: Be aware that SaMscL can exist in different oligomeric states depending on the detergent environment, with a pentameric structure in C8E5 and tetrameric in LDAO . This variability may affect functional properties and should be controlled for in experimental designs.

  • Strain Selection: Choose appropriate S. aureus strains for experiments, considering that laboratory reference strains (e.g., ATCC 29213) are well-characterized for MscL studies . Generate or obtain mscL knockout strains as essential negative controls.

  • Expression Systems: When expressing recombinant SaMscL, consider both heterologous (E. coli) and homologous (S. aureus) expression systems, each with advantages for different experimental purposes.

  • Functional Assays: Implement multiple complementary assays to assess MscL function, including growth inhibition, viability testing, and when possible, direct channel activity measurements.

  • Compound Handling: When working with MscL-targeting compounds like 011A or xanthorrhizol, be attentive to solubility limitations, potential precipitation, and stability under experimental conditions.

  • Reproducibility Factors: Standardize growth conditions, media composition, and cell density across experiments to minimize variability in MscL expression and function.

  • Interdisciplinary Approach: Recognize that comprehensive study of SaMscL benefits from combining microbiological, biophysical, and structural biology approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.