Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

3.1. Mechanism of Membrane Protein Insertion

YidC employs a two-step binding process :

  1. Initial Binding: Rapid (2 ms) interaction with the polypeptide via the cytoplasmic α-helical hairpin.

  2. Insertion: Strengthened binding (52 ms) and transfer of the substrate to the lipid bilayer via the hydrophilic groove.

Key Observations:

  • Single-molecule force spectroscopy revealed conformational variability in YidC during substrate binding .

  • Molecular dynamics simulations confirmed the role of the hydrophilic groove in facilitating α-helical insertion .

3.2. Evolutionary Conservation and Essentiality

YidC is absolutely conserved in S. aureus, with homologs present in archaea, mitochondria, and chloroplasts . Deletion attempts in S. aureus failed, underscoring its essentiality .

3.3. Synthetic Lethality and Interactions

  • G355 mutants in E. coli YidC require SecDF for viability, implicating this residue in SecY interaction .

  • S. aureus YidC complements E. coli YidC depletion but not SecDF loss, confirming species-specific Sec apparatus interactions .

Applications in Biomedical Research

ApplicationDescription
Structural StudiesCryo-EM and MD simulations to model YidC-ribosome complexes .
Antibiotic TargetYidC is a potential target for novel antimicrobials due to its essentiality .
Protein EngineeringHis-tagged recombinant YidC enables biochemical assays (e.g., lipoprotein studies) .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; SAV2090; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-290
Protein Length
Full Length of Mature Protein
Species
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Target Names
yidC
Target Protein Sequence
CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as in the integration of at least some lipoproteins.
Database Links

KEGG: sav:SAV2090

STRING: 158878.SAV2090

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of YidC in bacterial membrane protein biogenesis?

YidC functions as an essential membrane protein insertase in bacteria, facilitating the integration of various membrane proteins into the cytoplasmic membrane. It operates through two principal mechanisms: independently as a dedicated insertase, and cooperatively with the SecYEG translocon complex. During Sec-dependent insertion, transmembrane segments of nascent proteins thread through the SecYEG translocon and exit via a lateral gate in SecY, where YidC assists in transferring these segments into the lipid bilayer . This cooperative function is critical for proper membrane protein topology and folding. The independent YidC pathway is typically utilized by smaller membrane proteins that do not require the Sec machinery. YidC's central importance is demonstrated by its conservation across bacterial species and the lethal consequences of its depletion .

How does S. aureus YidC structure compare to E. coli YidC?

S. aureus YidC shares significant structural conservation with E. coli YidC, particularly in the transmembrane domains that constitute the functional core of the protein. Both proteins contain five conserved transmembrane segments arranged in a pentagonal pattern, though E. coli YidC contains an additional non-conserved transmembrane helix (TM1). The most highly conserved regions include transmembrane domains 2, 3, and 6, which form the central core of the insertase .

Key structural features found in both proteins include:

Structural ElementE. coli YidCS. aureus YidCFunctional Significance
Core TM domainsTM2-TM6 (5 helices)ConservedEssential for insertion activity
Helical paddle domainBetween TM2-TM3ConservedMembrane interaction
Glycine 355G355 in TM2InvariantCritical for SecY interaction
Periplasmic loopP1 loopShorterSpecies-specific interaction with SecF

Notably, G355 in E. coli YidC is invariant in S. aureus YidC, suggesting this highly conserved glycine serves a universal function in interactions with SecY across bacterial species .

Can S. aureus YidC complement YidC function in other bacterial species?

The complementation capacity is likely due to conservation of critical functional residues between the two species. For instance, the glycine at position 355 (G355) in E. coli YidC, which is crucial for interaction with SecY, is invariant in S. aureus YidC . This conservation of key interactive residues explains the cross-species functionality, while differences in other regions, particularly the periplasmic domains that interact with SecF, may account for the inability to fully complement all functions.

Which specific YidC residues are critical for interaction with the Sec apparatus?

Several specific residues in YidC have been identified as critical for its interaction with the Sec apparatus, particularly with SecY. These residues were discovered through synthetic lethal screens, revealing mutations that led to dependence on SecDF for viability. The following residues have been experimentally verified as crucial:

  • G355 in transmembrane domain 2 - When mutated, cells become dependent on SecDF for viability. Overexpression of SecY can partially rescue this defect, indicating direct or indirect interaction with SecY .

  • M471 - Another residue identified through synthetic lethal screening that appears to participate in interactions with SecY. Like G355, overexpression of SecY can partially rescue viability in strains containing M471 mutations in the absence of SecDF .

  • T362 in TM2 - Complete inactivation of YidC when mutated to alanine, suggesting a critical role in YidC stability or function .

  • Y517 in TM6 - Located at the same membrane height as T362, mutation to alanine completely inactivates YidC despite stable expression of the protein .

  • F433, F505 - Mutations in these residues show intermediate activity levels, indicating partial involvement in YidC function or stability .

Most of these critical residues are located within transmembrane domains rather than loop regions, highlighting the importance of transmembrane interactions for YidC function and Sec apparatus interaction .

How does the hydrophobic core of YidC contribute to membrane protein insertion?

The hydrophobic core of YidC plays a crucial role in facilitating membrane protein insertion through a carefully orchestrated series of interactions. Molecular dynamics simulations have revealed that the YidC transmembrane bundle is arranged with hydrophobic residues positioned on the exterior to stabilize interactions with the apolar lipid tails of the membrane . This arrangement creates an energetically favorable environment for transmembrane segment transit.

The interior of the YidC core exhibits a distinct organization that contributes to its insertion mechanism:

  • Cytoplasmic side: Predominantly polar or charged residues that engage in electrostatic and charge-dipole interactions, helping to orient incoming transmembrane segments .

  • Periplasmic side: Primarily aromatic residues involved in stacking and nonpolar dispersion interactions that likely facilitate the exit of transmembrane segments into the lipid bilayer .

This asymmetric distribution of residue types creates a gradient that helps direct the movement of substrate proteins through YidC and into the membrane. The hydrophobic exterior shields these interactions from the lipid environment while maintaining the structural integrity of the protein during the dynamic insertion process .

What conformational changes occur in YidC during membrane protein insertion?

YidC undergoes significant conformational changes during the membrane protein insertion process, as revealed by molecular dynamics simulations and structural analyses. When engaged with substrate proteins like the Pf3 coat protein, YidC exhibits greater flexibility and conformational dynamics compared to its substrate-free state .

Key conformational changes observed include:

  • Increased RMSD fluctuations - YidC shows approximately 2Å greater RMSD in the initial stages of insertion (pose 1) compared to later stages (pose 2), indicating substantial structural adaptation at the beginning of the insertion process .

  • Formation of an insertion groove - YidC transmembrane helices rearrange to create a hydrophilic groove that accommodates the substrate protein during insertion .

  • Helical paddle domain movement - The cytoplasmic helical hairpin between TM2 and TM3 shows significant mobility during simulations, suggesting it may play a role in substrate recognition or initial engagement .

  • Substrate-induced conformational adaptation - The substrate protein itself undergoes conformational changes, with varying bending angles observed as it progresses deeper into the YidC groove .

Principal component analysis (PCA) of molecular dynamics trajectories reveals that these conformational changes involve coordinated movements across the entire YidC structure. The first two principal components account for nearly 70% of the total variance in YidC movement during insertion, highlighting the importance of these specific conformational changes to the insertion mechanism .

What approaches can be used to identify critical YidC-Sec apparatus interaction sites?

Several complementary experimental approaches have proven effective for identifying critical YidC-Sec apparatus interaction sites:

  • Synthetic lethal screening - This genetic approach identifies YidC mutations that render cells dependent on SecDF for viability. The technique involves creating a library of YidC mutants and screening for those that cannot grow when SecDF is deleted or depleted. This method successfully identified G355 and M471 as residues that participate in interactions with SecY .

  • Overexpression rescue experiments - Once potential interaction residues are identified, their role in Sec apparatus interaction can be validated by testing whether overexpression of specific Sec components (like SecY) can rescue the growth defects caused by YidC mutations .

  • Cross-species complementation assays - Testing whether YidC from one species (e.g., S. aureus) can complement YidC or SecDF depletion in another species (e.g., E. coli) can reveal conserved interaction mechanisms. The observation that S. aureus YidC complements YidC but not SecDF depletion in E. coli provides insights into conserved and species-specific interaction sites .

  • Evolutionary covariation analysis - Computational analysis of multiple sequence alignments can identify pairs of residues that have co-evolved, indicating potential physical interactions. This approach successfully predicted several helix-helix contacts within YidC that were later confirmed experimentally .

  • In vivo complementation assays - Testing the ability of YidC mutants to complement YidC depletion provides a functional readout of the importance of specific residues. This approach confirmed the critical roles of T362 and Y517 in YidC function .

How can molecular dynamics simulations be optimized for studying YidC-mediated membrane insertion?

Optimizing molecular dynamics (MD) simulations for studying YidC-mediated membrane insertion requires careful consideration of several key parameters and methodological approaches:

  • Combined equilibrium and non-equilibrium simulations - A combination of equilibrium MD and non-equilibrium targeted MD (TMD) provides more comprehensive insights into the insertion mechanism than either approach alone. This combination has proven effective for investigating biological challenges including YidC-mediated insertion .

  • Appropriate membrane composition - The lipid composition significantly affects simulation results. For bacterial membrane proteins like YidC, a composition of 3 POPE to 1 POPG has been successfully used in multiple studies, accurately representing the bacterial membrane environment .

  • Simulation force field selection - The CHARMM36 force field for proteins and lipids, combined with the TIP3P water model, provides reliable results for membrane protein simulations .

  • System equilibration protocol:

    • Initial membrane surface construction (typically 110 Å × 110 Å along the XY plane)

    • Protein-lipid construct solvation with 25 Å thick water layers

    • System neutralization using Monte Carlo sampling of ions

    • Proper minimization and equilibration protocols before production runs

  • Analysis metrics - Key metrics to analyze include:

    • RMSD of both YidC and the substrate protein

    • Substrate protein bending angles

    • Principal component analysis to identify major conformational changes

    • Interaction energies between YidC, substrate, and lipids

    • Membrane thickness changes near the insertion site

  • Validation with experimental data - Computational predictions should be validated using experimental approaches such as in vivo complementation assays to test the functional importance of specific residues identified in simulations .

What in vivo complementation assay systems are most effective for testing S. aureus YidC function?

In vivo complementation assay systems are crucial for validating computational predictions and determining the functional significance of specific YidC residues. For testing S. aureus YidC function, several effective systems have been developed:

  • E. coli YidC depletion system - This system uses an E. coli strain where the chromosomal yidC gene is under control of an inducible promoter, allowing for controlled depletion. Complementation is tested by introducing plasmids expressing wild-type or mutant S. aureus YidC and assessing growth in depletion conditions .

  • Alanine mutagenesis complementation assay - This approach involves creating alanine mutations in specific residues predicted to be important for YidC function and testing their ability to complement YidC depletion. This method successfully identified T362 and Y517 as critical residues that completely inactivate YidC when mutated to alanine .

  • SecDF dependence assay - This assay tests whether specific YidC mutations render cells dependent on SecDF for viability, providing insights into which YidC residues are involved in interactions with the Sec apparatus .

  • Protein stability verification - When testing mutant YidC proteins that fail to complement, it is essential to verify that the lack of complementation is not simply due to protein instability. Western blot analysis can confirm stable expression of the mutant proteins .

The effectiveness of these assay systems can be enhanced by:

  • Using multiple bacterial host strains to test for species-specific effects

  • Employing various growth conditions to assess conditional phenotypes

  • Combining complementation assays with biochemical analyses of protein-protein interactions

  • Correlating complementation results with structural information to develop mechanistic insights

How should researchers interpret covariation analysis data for predicting YidC structure?

Covariation analysis has proven to be a powerful approach for predicting YidC structure, but proper interpretation requires careful consideration of several factors:

  • Identification of coupling patterns - The matrix of coupling strengths should be analyzed for diagonal and anti-diagonal patterns of stronger coupling coefficients, which indicate parallel or anti-parallel helix-helix pairs, respectively. These patterns were key to determining the pentagonal arrangement of YidC transmembrane helices .

  • Probability threshold determination - When computing probabilities for possible helix-helix contacts, it's important to establish clear thresholds. In YidC structure prediction, seven helix-helix contacts attained probabilities above 57%, while all others scored below 15%, demonstrating high specificity .

  • Integration with complementary data - Covariation analysis should be combined with other predictive methods such as:

    • Lipid or protein exposure predictions to inform helix rotation

    • Secondary structure predictions to guide modeling of non-TM regions

    • Evolutionary conservation data to identify functionally important residues

  • Structural modeling constraints - When using covariation data as constraints for structural modeling (e.g., with MODELLER), researchers should prioritize the residue-residue contacts with the highest coupling coefficients, while excluding intrahelical contacts, indels, and topology violations .

  • Validation through molecular dynamics - The stability of structures predicted through covariation analysis should be validated through MD simulations, examining inter-residue interactions within the TM region and monitoring structural stability over time .

  • Experimental verification - Key structural predictions should ultimately be tested experimentally, particularly for residues predicted to be involved in critical interactions. For YidC, predictions about the importance of T362 and Y517 were confirmed through in vivo complementation assays .

What metrics are most informative when analyzing molecular dynamics simulations of YidC-mediated insertion?

When analyzing molecular dynamics simulations of YidC-mediated insertion, several key metrics provide particularly valuable insights into the mechanism:

  • Protein RMSD measurements - Comparing the RMSD of YidC in different insertion stages reveals conformational changes during the process. Higher RMSD values (approximately 2Å greater) observed at the beginning of insertion compared to later stages indicate significant conformational adaptation by YidC .

  • Substrate protein bending angles - Analysis of bending angles in the substrate protein (e.g., Pf3 coat protein) reveals conformational changes as it progresses through the YidC groove. Lower bend angles at the start of insertion changing to higher angles deeper in the groove indicate adaptation to the YidC environment .

  • Principal Component Analysis (PCA) - PCA reveals the major modes of conformational change during insertion:

    • PC1 and PC2 typically account for 45-50% and 18-25% of total variance, respectively

    • Distinct clustering patterns in PC space between different insertion stages reflect significant conformational differences

    • Projection of square displacements onto structures visually demonstrates the direction and magnitude of structural fluctuations

  • Interaction energy analysis - Calculating interaction energies for each trajectory frame and averaging over time reveals key stabilizing interactions. This approach identified residues like T362 and Y517 as critical for YidC function .

  • Hydrogen bond networks - Defining hydrogen bonds based on geometric parameters (typical cutoffs: bond angle 20°, bond-length 3.8Å) between donors and acceptors helps identify stabilizing interactions within YidC and between YidC and substrate proteins .

  • Membrane thickness analysis - Measuring membrane thickness variations near YidC reveals how the insertase affects the local lipid environment. This is typically assessed by finding the nearest lipid head group and measuring minimum distances between phosphates on opposite leaflets .

  • Positional variance of helix residues - This metric quantifies flexibility and is calculated by summing deviations of individual backbone atom positions divided by the number of backbone atoms. This reveals which regions of YidC are most dynamic during insertion .

How can contradictions between computational predictions and experimental data for YidC be resolved?

Resolving contradictions between computational predictions and experimental data for YidC requires a systematic approach to identify and address potential sources of discrepancy:

  • Reassess model quality and docking accuracy - The quality of structural models and docking approaches significantly impacts simulation results. Contradictions may arise from inaccuracies in the initial models used for simulations .

  • Expand the conformational sampling - Limited conformational sampling in simulations may miss important states observed experimentally. Additional simulations using diverse starting conformations or enhanced sampling techniques can help address this limitation .

  • Refine force field parameters - Standard force fields may not accurately represent all aspects of membrane protein systems. Customized parameters based on experimental data can improve accuracy, particularly for specialized membrane environments .

  • Test multiple substrate proteins - YidC inserts various proteins that may use slightly different mechanisms. Testing multiple substrate proteins in various conformational states can provide a more comprehensive understanding of the insertion process and help reconcile apparent contradictions .

  • Implement hybrid approaches - Combining computational predictions with experimental constraints (e.g., using distance restraints derived from cross-linking experiments) can produce more accurate models that satisfy both computational and experimental data .

  • Validate critical predictions with targeted experiments - When computational predictions contradict experimental data, design specific experiments to test key aspects of the conflicting predictions. For instance, if simulations suggest a residue is critical but experiments show it's dispensable, perform more sensitive assays under various conditions to detect subtle effects .

  • Consider biological context - Computational models may not account for all biological factors present in experimental systems, such as interactions with additional proteins, variations in membrane composition, or cellular stress responses that might influence results .

What are the most promising approaches for studying the co-translational activity of S. aureus YidC?

The co-translational activity of S. aureus YidC represents a critical aspect of its function that warrants further investigation. Several promising approaches could advance our understanding in this area:

  • Cryo-electron microscopy of translating YidC-ribosome complexes - This approach has successfully revealed how E. coli YidC interacts with ribosomes at the tunnel exit and could be applied to S. aureus YidC to identify species-specific features of this interaction .

  • Real-time fluorescence spectroscopy - Developing fluorescently labeled YidC variants and substrate proteins could enable real-time monitoring of the insertion process, providing insights into the kinetics and stages of co-translational insertion.

  • Site-specific crosslinking during translation - This approach could capture transient interactions between nascent chain segments and specific regions of YidC during the insertion process, helping to map the insertion pathway in detail.

  • Comparative analysis of species-specific ribosome interactions - Given that S. aureus YidC can complement YidC but not SecDF function in E. coli, comparing ribosome interaction patterns between species could reveal important insights about co-translational mechanisms .

  • Combined experimental and computational approaches - Integration of structural data from cryo-EM with molecular dynamics simulations could provide a comprehensive view of the dynamic co-translational insertion process across different bacterial species.

These approaches would benefit from focusing on S. aureus-specific substrate proteins to ensure relevance to the native function of S. aureus YidC and could reveal important adaptations of the insertion machinery to the specific membrane environment and proteome of this clinically important pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.