Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA (sepA)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

SepA operates as a proton motive force-driven efflux pump, expelling substrates such as:

  • Antiseptics: Benzalkonium chloride, cetrimide .

  • Dyes: Ethidium bromide .

  • Antibiotics: Contributes to low-level resistance via substrate extrusion .

This efflux activity reduces intracellular drug concentrations, enabling S. aureus to survive in hostile environments .

Antibiotic Resistance

SepA is linked to multidrug resistance (MDR) phenotypes in S. aureus. Key findings include:

  • Overexpression in methicillin-resistant S. aureus (MRSA) correlates with enhanced tolerance to antiseptics and fluoroquinolones .

  • Works synergistically with other pumps (e.g., NorA) to broaden resistance profiles .

Biofilm Formation

SepA facilitates biofilm maturation by:

  • Cleaving the accumulation-associated protein (Aap), promoting extracellular matrix production .

  • Enhancing tolerance to antimicrobial agents within biofilms .

  • Regulating quorum-sensing molecules critical for biofilm development .

Research Applications

Recombinant SepA is widely used to:

  • Characterize Efflux Dynamics: Studies employ purified SepA to quantify substrate binding and extrusion kinetics .

  • Develop Inhibitors: High-throughput screens use recombinant SepA to identify efflux pump inhibitors (EPIs) .

  • Biofilm Studies: Genetic complementation assays (e.g., plasmid-borne sepA) restore biofilm formation in mutant strains .

Challenges and Future Directions

While SepA is a validated target for combating MDR S. aureus, key gaps remain:

  • Structural resolution of SepA’s transmembrane architecture.

  • Strain-specific variations in substrate specificity.

  • Clinical relevance of SepA in chronic infections vs. acute settings.

Efforts to develop EPIs targeting SepA could disrupt both antibiotic resistance and biofilm-associated infections .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
sepA; SACOL2158; Multidrug resistance efflux pump SepA; Antiseptic resistance protein SepA; Staphylococcal efflux pump A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
sepA
Target Protein Sequence
MIVNYLKHKFYNLLTTMIVLFIFVLSGAIFLTFLGFGLYGLSRILIYFRLGDFTYNRSMY DNLLYYGSYIIFGYFIIFAVEHLMDYFRKMLPENAYFRGATFHLISYTVATTLFYFIIHL NYVYINIDFWVIMVIIGFLYVCKLQFYPESKNLNNRK
Uniprot No.

Target Background

Function
Involved in multidrug efflux.
Database Links
Protein Families
Multidrug resistance efflux pump SepA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SepA in Staphylococcus species and what functions does it serve?

SepA can refer to two distinct proteins in Staphylococcus species with different functions:

In Staphylococcus aureus, SepA functions as a chromosomally-encoded efflux pump that contributes to multidrug resistance. It is part of a family of efflux systems that can extrude antibiotics from bacterial cells, reducing their intracellular concentration and effectiveness. Studies have shown extremely high prevalence (98.33%) of the sepA gene in clinical isolates, suggesting its importance in S. aureus survival .

In Staphylococcus epidermidis, SepA is a metalloprotease that plays a crucial role in biofilm formation. It processes the accumulation-associated protein (Aap), which is required for PIA-independent biofilm formation. SepA can cleave Aap at specific residues (Leu 335 and Leu 601), enabling its adhesive functions .

Methodology note: When designing experiments involving SepA, researchers must clearly specify which organism and which function of SepA they are investigating, as the confusion between these two distinct proteins with the same name can lead to experimental design flaws.

How is recombinant SepA typically produced for research purposes?

Recombinant SepA is typically produced using the following methodology:

  • Gene cloning: The sepA gene fragment (commonly amino acids 208-507 for S. epidermidis SepA) is inserted into an expression plasmid .

  • Host selection: Escherichia coli is the preferred expression host due to its rapid growth and high protein yields .

  • Tag integration: The recombinant protein is typically designed with N-terminal 10xHis tags and C-terminal Myc tags to facilitate purification and detection .

  • Expression conditions: Positive E. coli transformants are cultured under conditions that induce sepA expression .

  • Purification methods: Affinity chromatography using the His-tag is performed to isolate the recombinant protein from cell lysate .

  • Quality control: SDS-PAGE is used to verify purity, which typically exceeds 85% for commercial preparations .

  • Storage: The final product is either maintained in a Tris/PBS-based buffer with 5-50% glycerol (liquid form) or lyophilized with 6% trehalose (powder form) and stored at -20°C .

What experimental models are most appropriate for studying SepA function?

The choice of experimental model depends on which aspect of SepA function is being investigated:

For S. aureus efflux pump function:

  • Antibiotic susceptibility testing comparing wild-type and sepA knockout strains

  • Fluorescent substrate accumulation assays to directly measure efflux activity

  • Gene expression studies under antibiotic pressure

  • Combinations of efflux pump gene deletions to assess redundancy or synergy

For S. epidermidis biofilm formation:

  • Static biofilm models using microtiter plates

  • Flow cell systems for dynamic biofilm formation under shear stress

  • Genetic complementation studies using sepA plasmids in sepA-deficient strains

  • Exogenous addition of purified SepA to sepA-deficient strains

Methodology recommendation: For studying the specific contribution of SepA to biofilm formation, researchers should consider using the 1457Δica strain (PIA-deficient) as a background to eliminate confounding effects from polysaccharide-dependent biofilm mechanisms .

How does SepA interact with other efflux systems to confer multidrug resistance?

SepA rarely functions in isolation but rather as part of a complex network of efflux systems in S. aureus. Research findings show:

  • Co-expression patterns: SepA is frequently co-expressed with other chromosomally-encoded efflux genes including norA, norB, norC, mepA, and mdeA, with the combination norA+norB+norC+mepA+sepA+mdeA being most common in both MRSA and MSSA isolates .

  • Synergistic resistance: This genetic combination appears to confer resistance against fluoroquinolones (particularly ciprofloxacin) and potentially vancomycin .

  • Redundancy and compensation: When one efflux system is inhibited or deleted, others may increase expression to compensate, making single-target approaches less effective.

Table 1: Common Efflux Pump Gene Combinations in S. aureus and Associated Resistance Profiles

Efflux Pump CombinationPrevalence in Clinical IsolatesPrimary Resistance Profile
norA+norB+norC+mepA+sepA+mdeAHighest distributionCiprofloxacin, Vancomycin resistance
norA+norB+mepA+sepA+mdeAModerate distributionFluoroquinolone resistance
norA+sepA+mdeALower distributionVariable resistance patterns

Methodology insight: When designing inhibitor studies or gene knockout experiments, researchers should monitor expression changes in multiple efflux systems simultaneously to account for compensatory mechanisms.

What is the molecular mechanism of SepA-mediated biofilm formation in S. epidermidis?

SepA contributes to biofilm formation in S. epidermidis through a specific proteolytic cascade:

  • SepA cleaves the accumulation-associated protein (Aap) at two specific sites:

    • Leu 335 within the A domain

    • Leu 601 between the A and B domains

  • This proteolytic processing removes the inhibitory A domain of Aap, exposing the adhesive B domain.

  • The processed Aap can then promote intercellular adhesion through B domain interactions between adjacent cells.

  • This mechanism is independent of the polysaccharide intercellular adhesin (PIA) pathway, representing an alternative biofilm formation strategy .

The process is regulated by SarA, which represses sepA expression under standard growth conditions. Inactivation of sarA increases SepA production, subsequently enhancing Aap processing and biofilm formation .

Methodological approach: To experimentally verify this mechanism, researchers can use recombinant Aap fragments with fluorescent tags to visualize the processing events, or employ site-directed mutagenesis at the cleavage sites (Leu 335, Leu 601) to create non-cleavable variants and observe effects on biofilm formation.

How do experimental conditions affect the stability and activity of recombinant SepA?

The stability and activity of recombinant SepA are significantly influenced by experimental conditions:

  • pH dependence: As a metalloprotease (in S. epidermidis), SepA activity is typically optimal at neutral to slightly alkaline pH (7.0-8.5).

  • Metal ion requirements: SepA activity depends on metal ions, particularly zinc. Researchers should avoid chelating agents like EDTA in buffers when studying enzymatic activity.

  • Temperature sensitivity: Recombinant SepA stability decreases at temperatures above 4°C for extended periods, with significant activity loss above 25°C.

  • Freeze-thaw considerations: Repeated freeze-thaw cycles cause substantial activity reduction. Single-use aliquots are recommended for consistent results .

  • Buffer components: The presence of glycerol (5-50%) in storage buffers enhances protein stability, while trehalose (6%) is effective for lyophilized preparations .

Methodology recommendations:

  • Use fresh preparations when possible

  • Include appropriate controls for enzyme activity in each experiment

  • Consider time-course experiments to account for potential activity loss during extended protocols

  • Standardize protein concentrations based on active enzyme rather than total protein

What techniques can be used to assess SepA efflux pump activity?

Several complementary approaches can be used to evaluate SepA efflux activity:

  • Fluorescent substrate accumulation assays:

    • Ethidium bromide accumulation/efflux assay

    • Fluorescent-labeled peptide cleavage assays (similar to those used for Aureolysin)

    • Real-time monitoring of fluorescent substrate retention in the presence/absence of efflux inhibitors

  • Antibiotic susceptibility testing:

    • Minimum inhibitory concentration (MIC) determination

    • Checkerboard assays combining antibiotics with efflux inhibitors

    • Time-kill assays under various antibiotic concentrations

  • Gene expression analysis:

    • Quantitative RT-PCR to measure sepA expression under different conditions

    • RNA-Seq for genome-wide expression changes

    • Reporter gene constructs (e.g., sepA promoter fused to luciferase)

  • Protein production monitoring:

    • Western blotting for SepA protein levels

    • Protease activity assays using specific substrates

    • Mass spectrometry to identify SepA in membrane fractions

Detailed methodology: For fluorescent substrate assays, bacterial cells should be grown to mid-log phase, washed, and resuspended in buffer containing glucose as an energy source. The fluorescent substrate is added, and fluorescence is measured over time in the presence or absence of inhibitors or under ATP-depleting conditions.

How can researchers effectively generate and validate sepA knockout mutants?

Creating and validating sepA knockout mutants requires a systematic approach:

  • Knockout strategy selection:

    • Allelic replacement using homologous recombination

    • CRISPR-Cas9 system for precise gene editing

    • Transposon mutagenesis for random insertion libraries

  • Construction protocol:

    • Design primers targeting sepA-flanking regions

    • Create knockout construct with antibiotic resistance marker

    • Transform into S. aureus using appropriate methods (electroporation, phage transduction)

    • Select transformants on antibiotic-containing media

  • Validation techniques:

    • PCR verification of gene deletion

    • Quantitative RT-PCR to confirm absence of sepA transcript

    • Functional assays such as protease activity (for S. epidermidis SepA)

    • Complementation studies using plasmid-encoded sepA to restore phenotype

  • Phenotypic characterization:

    • Antibiotic susceptibility testing

    • Biofilm formation assays (particularly relevant for S. epidermidis)

    • Growth curve analysis to identify fitness costs

Example validation approach: The study by Chen et al. demonstrated successful sepA knockout validation in S. epidermidis by using a fluorescein-labeled peptide cleavage assay. The wild-type strain showed cleavage activity, while the ΔsepA mutant showed diminished activity. This phenotype was restored through complementation with a sepA-encoding plasmid .

What approaches are most effective for studying SepA regulation in Staphylococcus species?

SepA regulation can be studied through multiple complementary approaches:

  • Transcriptional regulation:

    • Promoter mapping using 5' RACE

    • Promoter-reporter fusion constructs

    • ChIP-seq to identify transcription factor binding sites

    • Quantitative RT-PCR under various growth conditions

  • Post-transcriptional regulation:

    • mRNA stability assays with transcription inhibitors

    • Northern blotting to detect regulatory RNAs

    • RNA-protein interaction studies (EMSA, RNA-IP)

  • Post-translational regulation:

    • Protein stability assays with translation inhibitors

    • Activity assays under different physiological conditions

    • Assessment of protein modification (phosphorylation, etc.)

Research finding: SepA in S. epidermidis is negatively regulated by the global regulator SarA. Quantitative RT-PCR revealed that sepA expression was significantly upregulated (22.3-fold) in a sarA knockout strain after 6 hours of growth, with continued upregulation (7.8-fold) after 16 hours. This transcriptional regulation correlated with increased SepA enzymatic activity as measured using a fluorescein-labeled peptide assay .

Methodological insight: When investigating regulatory networks, researchers should consider temporal aspects of gene expression, as regulation may change throughout growth phases or in response to environmental stressors.

What are the main challenges in purifying active recombinant SepA and how can they be addressed?

Purification of active recombinant SepA presents several challenges:

  • Protein solubility issues:

    • Challenge: SepA may form inclusion bodies in E. coli

    • Solution: Optimize growth temperature (typically 18-25°C), use solubility enhancement tags, or employ specialized E. coli strains designed for membrane protein expression

  • Maintaining enzymatic activity:

    • Challenge: Loss of metalloprotease activity during purification

    • Solution: Include appropriate metal ions (zinc) in purification buffers and avoid chelating agents

  • Protein stability concerns:

    • Challenge: SepA degradation during purification

    • Solution: Work at 4°C, include protease inhibitors, and minimize purification time

  • Tag interference with function:

    • Challenge: His-tags or other purification tags may affect protein activity

    • Solution: Design constructs with cleavable tags and compare activity before and after tag removal

Practical protocol considerations:

  • Use affinity chromatography (Ni-NTA for His-tagged constructs) as the primary purification step

  • Follow with size exclusion chromatography to remove aggregates

  • Verify purity using SDS-PAGE (aim for >85% purity)

  • Confirm activity with functional assays before proceeding to experiments

How can researchers differentiate between SepA functions in S. aureus versus S. epidermidis?

Differentiating between SepA functions requires specific experimental approaches:

  • Sequence analysis:

    • Perform phylogenetic analysis of sepA genes from both species

    • Identify conserved domains and species-specific regions

    • Use sequence alignments to predict functional differences

  • Functional assays:

    • For S. epidermidis SepA: Use protease activity assays with specific peptide substrates and biofilm formation assays

    • For S. aureus SepA: Employ antibiotic accumulation assays and susceptibility testing

  • Cross-species complementation:

    • Express S. aureus sepA in S. epidermidis sepA mutants and vice versa

    • Assess restoration of species-specific phenotypes

  • Structural biology approaches:

    • Generate structural models of both proteins

    • Identify structural differences that correlate with functional divergence

Methodology note: Researchers should explicitly state which organism's SepA they are working with in all publications to avoid confusion, as the similar naming belies significant functional differences.

What experimental designs are best suited for evaluating SepA inhibitors as potential antimicrobial agents?

Evaluating SepA inhibitors requires a structured experimental approach:

  • Primary screening methodologies:

    • Enzymatic assays using purified recombinant SepA

    • Virtual screening based on structural models

    • Fragment-based screening approaches

    • High-throughput cell-based screens

  • Secondary validation assays:

    • Dose-response curves to determine IC50 values

    • Mechanism of action studies (competitive vs. non-competitive inhibition)

    • Selectivity profiling against related proteases/efflux pumps

    • Cytotoxicity assessment against mammalian cells

  • Efficacy testing in relevant models:

    • Biofilm inhibition assays (for S. epidermidis SepA)

    • Antibiotic potentiation assays (for S. aureus SepA)

    • Time-kill assays in combination with conventional antibiotics

  • Advanced experimental design considerations:

    • Include appropriate controls (vehicle, known inhibitors)

    • Test against clinical isolates with varying antibiotic resistance profiles

    • Evaluate potential for resistance development through serial passage

Table 2: Experimental Design for SepA Inhibitor Evaluation

Assay TypePrimary EndpointExperimental SetupKey Controls
Enzymatic InhibitionIC50 determinationPurified SepA with fluorogenic substrateKnown metalloprotease inhibitors
Antibiotic PotentiationFold-reduction in MICCheckerboard assay with antibioticsEfflux pump knockout strains
Biofilm InhibitionBiofilm biomass reductionCrystal violet staining after treatmentsarA mutant (high SepA producer)
CytotoxicityCell viabilityMammalian cell lines with inhibitorDMSO vehicle control

Through this methodical approach, researchers can identify and characterize potential SepA inhibitors with therapeutic promise while minimizing false positives and addressing potential limitations early in development.

What are the emerging approaches for studying SepA in the context of Staphylococcus pathogenesis?

Several cutting-edge approaches are advancing our understanding of SepA's role in pathogenesis:

  • Single-cell experimental designs:

    • Single-cell RNA-seq to detect heterogeneity in sepA expression

    • Microfluidic approaches to track individual bacterial responses

    • Time-lapse microscopy with fluorescent reporters

  • Host-pathogen interaction studies:

    • Co-culture models with human cells

    • 3D tissue models that mimic infection microenvironments

    • In vivo imaging of SepA activity during infection

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis of SepA within regulatory and functional pathways

    • Mathematical modeling of efflux pump contribution to antibiotic resistance

  • Translational research opportunities:

    • Biomarker development based on SepA detection

    • Combination therapies targeting SepA along with conventional antibiotics

    • Vaccine approaches targeting conserved SepA epitopes

Methodology recommendation: Researchers interested in studying SepA in vivo should consider single-case experimental designs (SCEDs) which offer flexibility and cost-effectiveness for treatment development and personalized interventions, particularly for studying effects that can be replicated within or between cases .

How can researchers address the challenge of efflux pump redundancy when studying SepA?

Addressing efflux pump redundancy requires specialized experimental approaches:

  • Multiple gene deletion strategies:

    • Create combinatorial knockout mutants of efflux genes (sepA, norA, norB, norC, mepA, mdeA)

    • Use inducible expression systems to control multiple pumps simultaneously

    • Apply CRISPR interference for transient knockdown of multiple targets

  • Comprehensive resistance profiling:

    • Test susceptibility against diverse antibiotic classes

    • Measure actual intracellular antibiotic concentrations

    • Perform time-kill assays under varying antibiotic pressures

  • Expression correlation analysis:

    • Monitor expression of all major efflux pumps when sepA is deleted or inhibited

    • Identify compensatory upregulation patterns

    • Map regulatory networks controlling efflux pump expression

Research finding: Studies have shown that S. aureus isolates frequently carry multiple efflux pump genes simultaneously, with the combination norA+norB+norC+mepA+sepA+mdeA being most prevalent and associated with resistance to ciprofloxacin and vancomycin . This suggests that targeting SepA alone may not be sufficient to overcome resistance.

Methodological approach: Researchers should employ a systems biology framework that accounts for the interconnected nature of efflux mechanisms rather than studying SepA in isolation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.