Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit B1

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Staphylococcus aureus Na⁺/H⁺ antiporter subunit B1 (mnhB1) is a hydrophobic membrane protein encoded by the mnhB1 gene within the mnh operon. This subunit is part of a novel multisubunit Na⁺/H⁺ antiporter complex critical for ion homeostasis, pH regulation, and sodium extrusion in S. aureus. The recombinant form is engineered for functional studies and vaccine development .

Operon Organization

The mnh operon in S. aureus comprises seven open reading frames (mnhA to mnhG), forming a transcriptional unit essential for antiporter activity . Key features include:

  • Promoter and terminator: A promoter-like sequence upstream of mnhA and a terminator-like inverted repeat downstream of mnhG .

  • No internal promoters/terminators: Confirming the operon’s polycistronic structure .

Protein Features

  • Sequence: Recombinant subunit B1 corresponds to residues 1–142 of the full-length protein (UniProt ID: A5IRC9) .

  • Hydropathy: All seven subunits, including B1, are hydrophobic, suggesting transmembrane domains .

  • Homology: Shares sequence similarity with respiratory chain components, particularly complex I subunits (e.g., NuoL) .

Table 2: Key Functional Assays

Assay TypeResults
Growth rescueKNabc/pNAS20 cells grew in 0.8 M NaCl or 0.4 M LiCl
Antiport activity3.5–4.0 µmol Na⁺/min/mg protein at pH 7.0
ΔΨ generationEnhanced membrane potential (ΔΨ) in E. coli expressing Mrp/Mnh

Vaccine Development

  • Antigen potential: Subunit B1 is explored as a vaccine target due to its surface accessibility and role in pathogenicity .

  • Production: Available as a recombinant protein (50 µg–1 mg quantities) for immunological studies .

Research Tools

  • ELISA: Used to study antibody responses in S. aureus infections .

  • Mechanistic studies: Mutagenesis of conserved residues (e.g., Glu in MrpA C-terminal domain) reveals ion transport pathways .

Research Findings and Implications

  • Multisubunit complexity: The seven-subunit architecture distinguishes it from single-gene antiporters like NhaA .

  • Respiratory chain link: Homology with complex I suggests evolutionary conservation of ion transport mechanisms .

  • Biotechnological utility: Recombinant subunit B1 enables structure-function studies and anti-staphylococcal therapy design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
mnhB1; SA0812; Na(+/H(+ antiporter subunit B1; Mnh complex subunit B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
mnhB1
Target Protein Sequence
MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE
Uniprot No.

Target Background

Function
Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion.
Database Links

KEGG: sau:SA0812

Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Staphylococcus aureus Na(+)/H(+) antiporter system?

The Staphylococcus aureus Na(+)/H(+) antiporter is a novel multisubunit membrane protein complex that facilitates the exchange of sodium ions (Na+) for protons (H+) across the cell membrane. This system consists of seven distinct subunits that function together as an operon. The antiporter plays a crucial role in maintaining ion homeostasis, pH regulation, and salt tolerance in S. aureus. The system was initially characterized through cloning experiments using an Escherichia coli mutant lacking major Na+/H+ antiporters as a host system, demonstrating that the complete seven-subunit complex was necessary for functional antiport activity .

How does the structure of the Na(+)/H(+) antiporter in S. aureus differ from other bacterial antiporters?

Unlike many bacterial antiporters that function as single proteins, the S. aureus Na(+)/H+ antiporter represents a novel type of multisubunit transporter composed of seven distinct subunits. The genes encoding these subunits are arranged in an operon with a single promoter-like sequence upstream of the first open reading frame (ORF) and a terminator-like sequence downstream of the seventh ORF. Hydropathy analysis reveals that all seven proteins are highly hydrophobic, consistent with their roles as integral membrane components. Sequence similarity studies show that some subunits share homology with components of the respiratory chain, suggesting potential evolutionary relationships or functional convergence .

What expression systems are commonly used for producing recombinant S. aureus Na(+)/H(+) antiporter subunits?

Recombinant S. aureus Na(+)/H(+) antiporter subunits can be produced using several expression systems:

  • E. coli expression system: Most commonly used due to its simplicity, rapid growth, and high protein yields. This system has been successfully employed for the functional analysis of the Na(+)/H(+) antiporter complex .

  • Yeast expression systems: Offer eukaryotic post-translational modifications while maintaining relatively simple cultivation requirements.

  • Baculovirus expression systems: Provide high-level expression for more complex proteins requiring specific modifications.

  • Mammalian cell expression systems: Used when authentic mammalian post-translational modifications are required .

For optimal expression, the choice of vector, promoter strength, codon optimization, and purification tags must be carefully considered based on the specific research objectives.

What are the optimal conditions for expressing and purifying recombinant S. aureus Na(+)/H(+) antiporter subunit B1?

Expression Optimization:

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

  • Induction timing: Induce at mid-log phase (OD600 0.6-0.8)

  • Inducer concentration: Titrate IPTG (0.1-1.0 mM) to optimize expression

  • Expression duration: 4-16 hours for E. coli systems

Purification Protocol:

  • Harvest cells and resuspend in buffer containing protease inhibitors

  • Disrupt cells using sonication or mechanical methods

  • Isolate membrane fraction through differential centrifugation

  • Solubilize membrane proteins using detergents (DDM, LDAO, or Triton X-100)

  • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Perform size exclusion chromatography for increased purity

The recombinant protein should be maintained in detergent-containing buffers throughout purification to prevent aggregation. For long-term storage, maintain in glycerol-containing buffer at -20°C or -80°C .

How can I assess the functional activity of recombinant Na(+)/H(+) antiporter subunits?

Several complementary approaches can be used to assess functional activity:

  • Complementation studies: Transform E. coli mutants lacking endogenous Na+/H+ antiporters with the recombinant constructs and assess growth under high salt (0.2 M NaCl) or alkaline conditions. Functional complementation indicates active antiporter activity .

  • Membrane vesicle assays: Prepare everted membrane vesicles from cells expressing the antiporter and measure Na+/H+ exchange activity by monitoring:

    • pH changes using fluorescent probes (ACMA, pyranine)

    • Na+ flux using radioactive 22Na+ or Na+-sensitive fluorescent dyes

  • Reconstitution in proteoliposomes: Purify the antiporter and reconstitute into artificial liposomes to measure transport activity in a defined system.

  • Electrophysiological methods: For more detailed kinetic analyses, patch-clamp techniques can be applied to measure antiporter-mediated currents.

These functional assays should be performed with appropriate controls, including known antiporter inhibitors and inactive protein variants .

What strategies can be used to enhance the expression of recombinant S. aureus Na(+)/H(+) antiporter subunits?

To enhance expression of these challenging membrane proteins, consider implementing these research-validated strategies:

  • Fusion tags: The GB1 domain (B1 domain of Streptococcal protein G) has been shown to enhance expression of recombinant proteins by improving folding, solubility, and stability. This domain can be fused to the N-terminus of the target protein and later removed using specific proteases if necessary .

  • Codon optimization: Adapt the coding sequence to the codon usage bias of the expression host to improve translation efficiency.

  • Specialized expression strains: Use E. coli strains specifically designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)).

  • Chaperone co-expression: Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding.

  • Expression temperature modulation: Lower temperatures (16-20°C) often improve proper folding of membrane proteins.

  • Detergent screening: Systematic evaluation of different detergents for optimal solubilization and stability during purification .

How do Na(+)/H(+) antiporters contribute to S. aureus pathogenesis and antibiotic resistance?

Na(+)/H(+) antiporters play multifaceted roles in S. aureus pathogenesis and antibiotic resistance:

  • pH homeostasis: By mediating proton exchange, these antiporters help S. aureus maintain internal pH homeostasis in the face of acidic environments encountered during infection, including phagolysosomes and inflammatory sites.

  • Osmotic stress adaptation: Na(+)/H(+) antiporters contribute to osmoadaptation by regulating cytoplasmic Na+ levels, allowing survival in high-salt environments including the human skin.

  • Nitrosative stress resistance: Recent research has identified specific Na(+)/H(+) antiporters (such as nhaC and SAUSA300_0617) as contributing to resistance against nitric oxide (NO- ), a key component of the host immune response. Deletion mutants show increased sensitivity to nitrosative stress, indicating their role in surviving host defenses .

  • Membrane potential maintenance: By regulating cation gradients, these antiporters help maintain membrane potential, which can affect susceptibility to certain antimicrobials that target membrane integrity.

  • Drug efflux: Some antiporters may indirectly contribute to drug efflux by maintaining the ion gradients necessary for secondary active transport systems.

This multifunctional role makes Na(+)/H(+) antiporters potential targets for novel therapeutic approaches against MRSA and other antibiotic-resistant S. aureus strains .

What are the roles of different Na(+)/H(+) antiporter subunits in S. aureus physiology?

The seven subunits of the S. aureus Na(+)/H(+) antiporter complex appear to have distinct but complementary roles:

SubunitPutative FunctionPhysiological Role
A1/A2Channel formationCore transport pathway for ions
B1Sensor domainRegulation of transport activity
CAssembly factorComplex formation and stability
DEnergy couplingLinking proton motive force to transport
EpH sensingActivity regulation under different pH conditions
FCation selectivityDetermining ion specificity
GStabilizationMaintaining complex integrity

These assignments are based on structural predictions and homology analyses, as detailed functional characterization of each subunit is still emerging. Specific subunits appear particularly important in certain stress conditions; for example, deletion mutants lacking specific antiporter subunits show impaired growth under alkaline conditions, high salt concentrations, and during nitrosative stress, indicating specialized roles in these adaptive responses .

How can site-directed mutagenesis be used to investigate the transport mechanism of S. aureus Na(+)/H(+) antiporter?

Site-directed mutagenesis represents a powerful approach for dissecting the molecular mechanisms of the S. aureus Na(+)/H(+) antiporter:

Methodological Approach:

  • Target identification:

    • Identify conserved residues through sequence alignment with characterized antiporters

    • Focus on charged residues (Asp, Glu, Lys, Arg) that might participate in ion binding/translocation

    • Target residues in predicted transmembrane domains

  • Mutagenesis strategy:

    • Create conservative mutations (e.g., Asp to Asn) to maintain structure while altering function

    • Generate alanine-scanning libraries of putative functional domains

    • Create chimeric constructs between different antiporter subunits to identify functional domains

  • Functional characterization:

    • Assess ion transport kinetics (Km, Vmax) for each mutant

    • Determine pH profiles to identify residues involved in pH sensing

    • Examine cation selectivity (Na+ vs. Li+ vs. K+) to identify selectivity filter residues

  • Validation approaches:

    • Complementation studies in antiporter-deficient E. coli strains

    • Growth phenotype assessment under various stress conditions

    • Direct transport measurements using fluorescent probes or radioactive ions

This systematic mutagenesis approach can reveal residues essential for ion binding, translocation pathways, energy coupling, and regulatory mechanisms within the multisubunit complex .

What are common challenges in expressing membrane proteins like Na(+)/H(+) antiporter subunits, and how can they be addressed?

Membrane protein expression presents several challenges that require specific strategies:

ChallengeSolution Strategies
Protein aggregation- Lower expression temperature (16-20°C)
- Use specialized detergents (DDM, LDAO, GDN)
- Add stabilizing agents (glycerol, specific lipids)
Toxicity to host cells- Use tightly regulated inducible promoters
- Employ specialized expression strains (C41/C43)
- Use lower inducer concentrations
Low expression yields- Optimize codon usage
- Use fusion partners (GB1, MBP, SUMO)
- Screen multiple constructs with different boundaries
Improper membrane insertion- Include proper signal sequences
- Co-express membrane insertases or translocases
- Use membrane-mimetic environments during purification
Heterogeneous protein population- Optimize solubilization conditions
- Employ multiple purification steps
- Use size exclusion chromatography as final step

For the S. aureus Na(+)/H(+) antiporter specifically, expressing the complete seven-subunit complex may be necessary for proper folding and function, as individual subunits might be unstable or non-functional when expressed alone .

How can I troubleshoot functional assays for Na(+)/H(+) antiporter activity?

When troubleshooting functional assays for Na(+)/H(+) antiporter activity, consider these common issues and solutions:

For fluorescence-based pH monitoring:

  • Problem: Weak or absent signal

  • Solutions:

    • Verify probe loading (optimize concentration and incubation time)

    • Confirm membrane vesicle integrity using control ionophores

    • Increase protein-to-lipid ratio in reconstitution experiments

    • Ensure adequate buffering capacity of assay solutions

For growth-based complementation assays:

  • Problem: Lack of complementation

  • Solutions:

    • Verify expression of all subunits (Western blot)

    • Optimize expression conditions (temperature, inducer concentration)

    • Test different stress conditions (vary salt concentration or pH)

    • Consider that all seven subunits may be required for function

For direct ion flux measurements:

  • Problem: High background or inconsistent results

  • Solutions:

    • Use ionophore controls to determine maximum response

    • Perform time-course measurements to capture transient activity

    • Calibrate systems carefully with known standards

    • Control for non-specific binding of indicators to membranes

Each assay system requires specific optimization, and combining multiple assay approaches provides more robust evidence of antiporter function .

What strategies can be employed to study interactions between subunits of the Na(+)/H(+) antiporter complex?

Investigating subunit interactions within the multisubunit Na(+)/H(+) antiporter complex requires specialized approaches:

  • Cross-linking studies:

    • Chemical cross-linking with BS3, DSS, or formaldehyde followed by MS analysis

    • Photo-crosslinking with genetically incorporated photo-reactive amino acids

    • Analysis of cross-linked products by mass spectrometry to identify interaction interfaces

  • Co-immunoprecipitation approaches:

    • Tag individual subunits with different epitopes (His, FLAG, HA)

    • Perform pull-down experiments to identify interaction partners

    • Quantify interaction strength under different conditions (pH, salt)

  • FRET/BRET analysis:

    • Generate fusion constructs with fluorescent proteins or luciferase

    • Measure energy transfer as indicator of proximity between subunits

    • Perform in living cells to capture dynamic interactions

  • Split-protein complementation:

    • Fuse fragments of reporter proteins (GFP, luciferase) to different subunits

    • Functional reporter indicates successful interaction

    • Can be performed in vivo to assess physiological relevance

  • Proteoliposome reconstitution:

    • Systematic omission of individual subunits to determine minimal functional complex

    • Sequential addition of purified subunits to identify assembly pathway

    • Determine stoichiometry through quantitative protein analysis

These approaches can reveal the architecture of the complex, assembly mechanisms, and how subunit interactions change during the transport cycle .

How might Na(+)/H(+) antiporters be targeted for antimicrobial development against S. aureus?

Na(+)/H(+) antiporters represent promising novel targets for antimicrobial development against S. aureus, particularly antibiotic-resistant strains like MRSA. Several strategic approaches warrant investigation:

  • Direct inhibition strategies:

    • Develop small molecule inhibitors targeting conserved regions of transport pathway

    • Design peptidomimetics that disrupt subunit interactions within the complex

    • Create cation mimetics that compete for binding but block translocation

  • Vulnerability exploitation:

    • Target subunits specifically required for stress adaptation (pH, salt, nitrosative)

    • Develop compounds that convert the antiporter into a non-regulated channel, disrupting ion homeostasis

    • Create "molecular plugs" that physically block the transport pathway

  • Combination approaches:

    • Pair antiporter inhibitors with conventional antibiotics for synergistic effects

    • Combine with compounds that enhance nitrosative stress to overwhelm bacterial defenses

    • Develop dual-action molecules targeting both antiporters and related stress-response systems

Recent research identifying Na(+)/H(+) antiporters as contributors to nitrosative stress resistance in S. aureus provides particular promise, as this mechanism helps bacteria evade host immune defenses. Compounds targeting these transporters might sensitize S. aureus to host-derived antimicrobial effectors, creating a host-pathogen synergistic approach to treatment .

What structural biology techniques are most promising for elucidating the structure of the complete S. aureus Na(+)/H(+) antiporter complex?

Determining the structure of the complete seven-subunit Na(+)/H(+) antiporter complex presents significant challenges that require cutting-edge structural biology approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Most promising for intact complex structure determination

    • Can resolve structures without crystallization

    • Recent advances in detectors and processing allow near-atomic resolution

    • Sample preparation challenges: maintaining complex integrity during grid preparation

  • X-ray crystallography:

    • Higher resolution potential but challenging for membrane protein complexes

    • Requires stable, homogeneous crystal formation

    • Lipidic cubic phase or bicelle crystallization methods may improve success

    • May be more suitable for individual subunits than complete complex

  • Integrative structural biology approaches:

    • Combine low-resolution cryo-EM with high-resolution structures of individual domains

    • Use cross-linking mass spectrometry to define subunit interfaces

    • Apply molecular dynamics simulations to refine structural models

    • Validate with functional studies of designed mutations

  • Native mass spectrometry:

    • Determine stoichiometry and interaction network of the complex

    • Monitor stability under different conditions

    • Identify small molecule binding sites

These approaches would provide crucial insights into the architecture of this unusual multisubunit antiporter, potentially revealing novel mechanisms of ion transport coordination across multiple protein subunits .

How do Na(+)/H(+) antiporters interact with other membrane transport systems in S. aureus during stress adaptation?

S. aureus likely employs coordinated networks of transporters during stress adaptation, with Na(+)/H(+) antiporters playing central roles:

  • Integration with pH homeostasis systems:

    • Potential coordination with F1F0-ATPase activity

    • Functional interactions with carbonic anhydrases

    • Compensatory relationships with K+/H+ antiporters

    • Research approach: Simultaneous monitoring of multiple ion fluxes during pH stress

  • Connections to nutrient acquisition systems:

    • Ion gradients maintained by Na(+)/H(+) antiporters may drive secondary active transporters

    • Potential co-regulation with amino acid or peptide transporters

    • Research approach: Transcriptomics/proteomics of transporter networks under stress conditions

  • Involvement in membrane potential maintenance:

    • Cross-talk with respiratory chain components

    • Coordination with other ion channels and transporters

    • Research approach: Membrane potential measurements in antiporter mutants

  • Role in resistance to host antimicrobial peptides:

    • Potential interactions with membrane modification systems

    • Contributions to maintenance of membrane charge distribution

    • Research approach: Susceptibility testing of antiporter mutants to various antimicrobial peptides

Understanding these interactions requires systems biology approaches combining transcriptomics, proteomics, and metabolomics with targeted functional studies of transporter mutants under various stress conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.