Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit B1 (mnhB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Na⁺/H⁺ Antiporter Subunit B1 (mnhB1)

Recombinant Staphylococcus aureus Na⁺/H⁺ antiporter subunit B1 (mnhB1) is a laboratory-produced protein corresponding to the B1 subunit of the Mnh1 antiporter complex. This multisubunit cation/proton antiporter plays critical roles in pH homeostasis and salt tolerance in S. aureus, enabling survival under extreme environmental conditions . MnhB1 is one of seven hydrophobic membrane-bound subunits that form the functional Mnh1 antiporter, which facilitates Na⁺/H⁺ exchange, particularly under neutral to alkaline pH conditions .

Role in Ion Transport

The Mnh1 antiporter (including mnhB1) mediates Na⁺/H⁺ exchange with optimal activity at pH 7.5 . This activity is vital for maintaining cytoplasmic pH during alkaline stress or high extracellular Na⁺ concentrations .

Salt and pH Stress Adaptation

Mnh1 (including mnhB1) supports S. aureus growth under:

  • Elevated Na⁺ concentrations: Deletion of mnhA1 (encoding Mnh1 subunits) reduces growth rates at pH 7.5–9.0 .

  • Alkaline environments: Mnh1 compensates for pH-dependent stress, enabling survival in environments with pH >8.5 .

Virulence in S. aureus

Deletion of mnhA1 (but not mnhA2, encoding Mnh2 subunits) severely attenuates virulence in mouse infection models:

  • Bacterial burden: ΔmnhA1 strains show ~5-log reduction in kidney colonization compared to wild-type .

  • Complementation: Reintroducing mnhA1 restores virulence, confirming mnhB1’s critical role in pathogenesis .

Comparative Analysis of Mnh1 and Mnh2 Antiporters

PropertyMnh1 (mnhB1)Mnh2
Catalytic ActivityNa⁺/H⁺ exchange (pH 7.5) Na⁺/H⁺ and K⁺/H⁺ exchange (pH 8.5)
Salt ToleranceHalotolerance at neutral pH Osmotolerance and halotolerance
VirulenceEssential for pathogenesis No significant role
RegulationConstitutive expression Induced by σᴮ under stress

Research Applications

Recombinant mnhB1 is used for:

  • Structural studies: Characterizing antiporter subunit interactions .

  • Functional assays: Measuring Na⁺/H⁺ exchange kinetics in everted vesicles .

  • Target discovery: Identifying inhibitors for antimicrobial therapy .

Product Overview

SupplierProduct DescriptionPrice (USD)Source
MyBioSourcemnhB1 (1–142 aa), His-tagged$1,415.00E. coli
Creative BiolabsmnhB (1–142 aa, strain Newman), His-taggedN/AE. coli/yeast
Creative BiomartFull-length mnhB1 (Q5HHD4), His-taggedN/AE. coli

Key Notes:

  • Strain Variability: Products derived from strain Newman or other clinical isolates .

  • Storage: Typically -20°C to -80°C for lyophilized/stabilized formats .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhB1; SAUSA300_0854; Na(+/H(+ antiporter subunit B1; Mnh complex subunit B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Staphylococcus aureus (strain USA300)
Target Names
mnhB1
Target Protein Sequence
MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE
Uniprot No.

Target Background

Function
Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion.
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the mnhB1 subunit within the multisubunit Na(+)/H(+) antiporter complex?

The mnhB1 subunit is one of seven hydrophobic membrane-bound protein subunits that comprise the Mnh1 antiporter system in Staphylococcus aureus. Research indicates that all seven open reading frames (ORFs) are necessary for complete antiporter function, with each subunit playing a specific role in the cation exchange mechanism . Hydropathy analysis has revealed that the mnhB1 protein, like other subunits in the complex, is highly hydrophobic, suggesting multiple transmembrane domains that contribute to cation transport across the cell membrane . Sequence analysis has shown homology between some Mnh antiporter subunits and components of respiratory chain systems, indicating potential evolutionary relationships between these membrane transport systems .

How does the Mnh1 antiporter system containing mnhB1 differ from the Mnh2 system in S. aureus?

The Mnh1 and Mnh2 antiporter systems in S. aureus exhibit distinct catalytic properties and physiological roles despite their structural similarities. Research has demonstrated that the Mnh1 antiporter (which includes the mnhB1 subunit) shows significant Na(+)/H(+) exchange activity primarily at neutral to mildly alkaline conditions (pH 7.5) . In contrast, the Mnh2 antiporter demonstrates broader substrate specificity with significant exchange of both Na(+)/H(+) and K(+)/H(+) cations, particularly at more alkaline conditions (pH 8.5) . These functional differences suggest that the corresponding subunits, including mnhB1 in Mnh1 and its counterpart in Mnh2, have evolved specialized roles in maintaining ion homeostasis under different environmental conditions.

What experimental systems have been used to characterize mnhB1 function?

The function of mnhB1 as part of the Mnh1 antiporter has primarily been studied using complementation systems in antiporter-deficient bacteria. A common approach involves:

  • Cloning S. aureus antiporter genes into expression vectors

  • Transforming these constructs into E. coli mutant strains (KNabc) lacking endogenous Na(+)/H(+) antiporters

  • Assessing growth restoration under challenging salt or pH conditions

  • Measuring cation/proton exchange in everted (inside-out) membrane vesicles

This heterologous expression approach has proven valuable for determining the catalytic properties of the complete antiporter system. Additionally, gene knockout studies in S. aureus have been employed to assess the physiological importance of the antiporter systems under various stress conditions .

What is the genetic organization of the operon containing mnhB1?

The mnhB1 gene is part of a seven-gene operon encoding the complete Mnh1 antiporter complex. The operon structure includes:

  • A promoter-like sequence upstream of the first ORF

  • Seven consecutive ORFs encoding the antiporter subunits

  • An inverted repeat followed by a T-cluster (potential terminator) downstream of the seventh ORF

  • Absence of terminator-like or promoter-like sequences between the ORFs

This genetic organization suggests that all seven subunits are co-transcribed as a single polycistronic mRNA, ensuring coordinated expression of all components required for functional antiporter assembly. The precise position of mnhB1 within this operon is critical for understanding its regulation in response to environmental stressors.

What is the potential role of mnhB1 in S. aureus virulence?

The connection between mnhB1 and virulence can be inferred from studies on the Mnh1 antiporter system. Research has demonstrated that deletion of mnhA1 leads to a major loss of S. aureus virulence in mouse infection models, whereas deletion of components of the Mnh2 system did not significantly affect virulence . Given that mnhB1 is an essential component of the Mnh1 complex, it likely contributes significantly to the virulence phenotype. The mechanistic basis may involve:

  • Maintenance of cytoplasmic pH homeostasis during infection

  • Adaptation to host-imposed ionic stress

  • Proper functioning of virulence factor expression systems dependent on ion gradients

  • Survival in specific host microenvironments with distinctive pH or salt conditions

The differential virulence impact between Mnh1 and Mnh2 systems underscores the specialized role of the Mnh1 complex, including mnhB1, in pathogenesis.

How can recombinant mnhB1 be effectively expressed and purified for structural studies?

Expression and purification of hydrophobic membrane proteins like mnhB1 present significant technical challenges. Based on approaches used for similar membrane proteins, the following methodological framework is recommended:

StepMethodCritical Considerations
Expression systemE. coli C41(DE3) or C43(DE3) strainsSpecifically designed for membrane protein expression
Vector selectionpET or pBAD series with appropriate tagsInducible expression with purification tags (His, FLAG)
InductionLow IPTG/arabinose concentration, reduced temperature (16-20°C)Prevents aggregation and improves folding
Membrane extractionDifferential centrifugation followed by detergent solubilizationSelection of appropriate detergent (DDM, LMNG) critical
PurificationIMAC followed by size exclusion chromatographyDetergent maintenance throughout purification
Functional verificationReconstitution into proteoliposomesVerification of activity in artificial membrane systems

For structural studies, stability screening with different detergents and lipids is crucial before attempting crystallization or cryo-EM studies. Co-expression with other subunits may be necessary to maintain proper folding and stability, as mnhB1 likely has evolved to function within the multisubunit complex .

What are the implications of homology between mnhB1 and respiratory chain components?

The observed sequence similarity between Mnh antiporter subunits and components of the respiratory chain suggests potential evolutionary and functional relationships . This homology raises several important research implications:

  • Shared structural motifs may indicate conserved mechanisms for ion translocation across membranes

  • Possible coordination between respiration and ion transport processes

  • Potential functional coupling between electron transport and cation/proton antiport activities

Research has demonstrated that respiration drives significant Na(+) extrusion in cells expressing the Mnh antiporter system, although this activity remains sensitive to proton conductors, confirming its function as an antiporter rather than a primary respiratory Na(+) pump . Further investigation of the specific homologous regions in mnhB1 could provide insights into the molecular mechanisms of coupling between these two fundamental processes in bacterial physiology.

What controls should be included when assessing recombinant mnhB1 function in experimental systems?

When investigating recombinant mnhB1 function, comprehensive controls are essential to ensure reliable results:

  • Negative controls:

    • Empty vector transformants lacking any antiporter genes

    • Transformants expressing mnhB1 alone without other subunits

    • System containing inactive mnhB1 (site-directed mutants)

  • Positive controls:

    • Complete reconstituted Mnh1 complex

    • Known functional Na(+)/H(+) antiporters (NhaA from E. coli)

    • Wild-type S. aureus strains

  • Experimental validation:

    • Growth assays under varying salt concentrations (0.2M NaCl, 10mM LiCl)

    • pH tolerance tests (pH range 7.5-9.5)

    • Direct measurement of Na(+)/H(+) exchange in membrane vesicles

    • Respiration-driven Na(+) extrusion measurements with and without proton conductors

These controls help distinguish between direct mnhB1 effects and indirect consequences of experimental manipulation, while verifying that observed phenotypes are specifically related to antiporter function rather than artifacts.

How should researchers design experiments to investigate the topology of mnhB1 in the membrane?

Determining the membrane topology of mnhB1 requires a multi-method approach:

  • Computational prediction:

    • Hydropathy analysis to identify potential transmembrane domains

    • Topology prediction algorithms (TMHMM, Phobius)

    • Comparative analysis with homologous proteins of known structure

  • Experimental verification:

    • Reporter fusion constructs (PhoA/LacZ) at various positions

    • Cysteine scanning mutagenesis with membrane-permeable and impermeable thiol reagents

    • Protease protection assays with inside-out and right-side-out membrane vesicles

    • Epitope tagging at predicted loop regions with antibody accessibility testing

  • Advanced structural approaches:

    • Cryo-electron microscopy of the entire complex

    • Cross-linking experiments to identify neighboring subunits

    • Hydrogen-deuterium exchange mass spectrometry to identify exposed regions

By combining computational predictions with multiple experimental approaches, researchers can develop a comprehensive model of mnhB1 orientation within the membrane and its relationship to other subunits in the complex.

What experimental approaches can determine mnhB1's contribution to salt tolerance mechanisms?

To elucidate mnhB1's specific role in salt tolerance, a systematic experimental approach should include:

  • Genetic manipulation:

    • Generation of mnhB1 deletion mutants

    • Complementation with wild-type and mutant variants

    • Creation of chimeric proteins with corresponding subunits from Mnh2

  • Physiological characterization:

    • Growth curves under varying salt concentrations (0.1-1.0M NaCl)

    • Survival assays following osmotic shock

    • Intracellular Na(+) and H(+) measurements using ion-specific fluorescent probes

    • Membrane potential measurements under salt stress

  • Biochemical analysis:

    • Na(+)/H(+) exchange activity in membrane vesicles at different pH values

    • Effect of site-directed mutations on cation specificity and transport rates

    • Kinetic parameters (Km, Vmax) determination for various cations

  • In vivo relevance:

    • Competition assays between wild-type and mnhB1 mutants in fluctuating salt environments

    • Transcriptomic analysis of compensatory responses to mnhB1 loss

This comprehensive approach will establish whether mnhB1 plays a direct role in ion translocation or serves a more structural or regulatory function within the Mnh1 complex.

How can researchers reconcile contradictory results regarding mnhB1 function across different experimental systems?

Contradictory results regarding mnhB1 function may arise from several sources. A systematic approach to reconciliation includes:

  • Experimental system comparison:

    • Heterologous expression systems versus native S. aureus background

    • In vitro reconstitution versus whole-cell studies

    • Different growth or assay conditions (temperature, pH, media composition)

  • Methodological analysis:

    • Sensitivity and specificity of different antiport activity assays

    • Time-dependent effects that may be missed in endpoint measurements

    • Influence of membrane composition on antiporter function

  • Strain-specific variations:

    • Genetic background differences between S. aureus strains

    • Potential compensatory mechanisms in different strains

    • Sequence variations in mnhB1 or interacting partners

  • Integrative interpretation:

    • Development of models that accommodate apparently contradictory data

    • Meta-analysis of published results with weighted reliability criteria

    • Direct replication studies under standardized conditions

When results from E. coli expression systems differ from native S. aureus studies, researchers should consider that the membrane environment, accessory proteins, or post-translational modifications may differ between systems, potentially altering mnhB1 function.

What bioinformatic approaches are useful for analyzing mnhB1 structural features and evolutionary relationships?

Several bioinformatic approaches can yield valuable insights into mnhB1 structure and evolution:

  • Sequence analysis:

    • Multiple sequence alignment of mnhB1 homologs across bacterial species

    • Identification of conserved motifs potentially critical for function

    • Detection of coevolving residues indicating functional interactions

  • Structural prediction:

    • Homology modeling based on related proteins with known structures

    • Ab initio structure prediction using methods like AlphaFold

    • Molecular dynamics simulations to predict conformational changes

  • Evolutionary analysis:

    • Phylogenetic tree construction for mnhB1 and related proteins

    • Selection pressure analysis to identify functionally constrained regions

    • Horizontal gene transfer detection to understand antiporter distribution

  • Integrative approaches:

    • Correlation of sequence variations with species adaptation to different environments

    • Prediction of protein-protein interaction interfaces

    • Mapping of known functional mutations onto structural models

These approaches can help identify critical regions of mnhB1 that warrant targeted experimental investigation and place the protein in an evolutionary context that explains its specialized function in S. aureus.

How should researchers interpret differences in mnhB1 expression under various environmental conditions?

Changes in mnhB1 expression under different environmental conditions provide insights into its physiological roles. Interpretation should consider:

  • Expression pattern analysis:

    • Correlation with specific stressors (salt, pH, temperature)

    • Temporal dynamics of expression changes

    • Comparison with expression changes in other antiporter subunits

  • Regulatory mechanisms:

    • Identification of transcription factors binding to the Mnh1 operon promoter

    • Analysis of potential post-transcriptional regulation

    • Evaluation of coordinated regulation with other stress response systems

  • Functional correlation:

    • Association between expression changes and physiological adaptations

    • Connection to virulence factor expression under similar conditions

    • Impact on bacterial fitness in relevant environments

  • Translational significance:

    • Implications for bacterial survival during infection

    • Potential as a diagnostic marker for adaptation to specific host niches

    • Evaluation as a potential therapeutic target

For example, upregulation of mnhB1 under high salt conditions would suggest its importance in osmoregulation, while induction during host infection might indicate a role in pathogenesis, consistent with the observed virulence defects in mnhA1 deletion mutants .

How might inhibition of mnhB1 affect S. aureus virulence in potential therapeutic applications?

Based on the significant virulence attenuation observed in mnhA1 deletion mutants, targeting the Mnh1 antiporter complex, including the mnhB1 subunit, represents a promising therapeutic strategy . Inhibition of mnhB1 would likely:

  • Compromise bacterial ion homeostasis under the variable conditions encountered during infection

  • Reduce bacterial survival in high-salt environments within the host

  • Potentially increase sensitivity to antimicrobial peptides that disrupt membrane integrity

  • Attenuate virulence factor expression or secretion that depends on proper ion gradients

Development of mnhB1 inhibitors would require structure-based drug design approaches, potentially targeting unique features that distinguish it from human transporters. Given that deletion of mnhA1 significantly reduced virulence while deletion of Mnh2 components did not affect virulence, targeted inhibition of the Mnh1 complex appears more promising for therapeutic development .

How does recombinant mnhB1 compare with other S. aureus antiporter subunits as a potential vaccine component?

Assessment of mnhB1 as a potential vaccine component should consider:

CharacteristicConsiderations for mnhB1Comparison with Other Antiporter Subunits
ImmunogenicityLikely limited due to membrane localizationSurface-exposed subunits may offer better targets
ConservationHigh conservation across S. aureus strains beneficialVariable regions may limit broad protection
AccessibilityPredominantly embedded in membrane limits antibody accessSubunits with extracellular domains preferable
Functional importanceEssential role supports vaccine strategyAll seven subunits appear essential
Prior vaccine successLimited precedent for membrane transporters as vaccinesSurface proteins and toxins have shown more promise

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.