Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit C1

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Na⁺/H⁺ Antiporter Subunit C1

Recombinant Na⁺/H⁺ antiporter subunit C1 (UniProt ID: A7X0G0) is a 113-amino-acid transmembrane protein expressed in Escherichia coli with an N-terminal His tag for purification . It belongs to the Mnh complex, a putative seven-subunit Na⁺/H⁺ antiporter system in S. aureus implicated in sodium extrusion, pH regulation, and osmotic stress tolerance .

Operon Architecture

Subunit C1 is encoded by the mnhC1 gene, part of a seven-gene operon (mnhA–mnhG) essential for antiport activity. This operon lacks internal promoters or terminators, suggesting coordinated transcription .

GenePutative Function
mnhASubunit A (regulatory role)
mnhBSubunit B (ion-binding domain)
mnhC1Subunit C1 (transmembrane transport)
mnhDSubunit D (proton translocation)
mnhE1Subunit E1 (structural stabilization)
mnhFSubunit F (energy coupling)
mnhGSubunit G (unknown function)

Na⁺/H⁺ Antiport Activity

  • Mechanism: The Mnh complex exchanges intracellular Na⁺/Li⁺ for extracellular H⁺, driven by the proton motive force .

  • pH Dependence: Active at neutral pH (7.0–8.0), unlike E. coli NhaA, which functions optimally at alkaline pH .

  • Substrate Specificity: Transports Na⁺ (Km = 0.8 mM) and Li⁺ (Km = 2.1 mM) .

Physiological Roles

  • Osmoregulation: Enables S. aureus survival in high-salt environments (up to 3 M NaCl) .

  • pH Homeostasis: Compensates for cytoplasmic alkalinization under stress .

  • Respiration Coupling: Na⁺ extrusion is inhibited by protonophores (e.g., CCCP), confirming H⁺-dependent transport .

Heterologous Expression in E. coli

  • Growth Rescue: E. coli KNabc mutants (ΔnhaA/ΔnhaB/ΔchaA) expressing mnhC1 regained growth in 0.2 M NaCl or 10 mM LiCl .

  • Activity Assay: Membrane vesicles from transformed E. coli showed Na⁺/H⁺ antiport activity (16.8 nmol/min/mg protein) via quinacrine fluorescence quenching .

Biotechnological Applications

  • Drug Target: Potential candidate for inhibitors disrupting bacterial ion homeostasis.

  • Research Tool: Used to study ion transport mechanisms in extremophiles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
mnhC1; SA0811; Na(+/H(+ antiporter subunit C1; Mnh complex subunit C1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
mnhC1
Target Protein Sequence
MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
Uniprot No.

Target Background

Function
The Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion.
Database Links

KEGG: sau:SA0811

Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Staphylococcus aureus Na+/H+ antiporter system?

The Staphylococcus aureus Na+/H+ antiporter is a novel multisubunit membrane protein complex that mediates the exchange of sodium ions (Na+) for protons (H+) across the cell membrane. Research has revealed that this antiporter consists of seven different subunits encoded by seven open reading frames (ORFs) that form a functional operon . All proteins in this complex are hydrophobic in nature, and the system plays crucial roles in sodium homeostasis, pH regulation, and resistance to environmental stresses . The Na+/H+ antiporter is not a respiratory Na+ pump but functions as an authentic antiporter, as demonstrated by its sensitivity to H+ conductors .

How does the Na+/H+ antiporter contribute to S. aureus physiology?

The Na+/H+ antiporter system is essential for S. aureus adaptation to various environmental conditions. It enables bacterial growth in high salt concentrations (up to 0.2 M NaCl) and alkaline conditions . When introduced into E. coli mutants lacking major Na+/H+ antiporters, the S. aureus antiporter system restored growth ability in high-salt media and under alkaline conditions . Recent research has also linked Na+/H+ antiporter function to nitrosative stress resistance, suggesting its importance in pathogenesis and survival within host environments .

How does the S. aureus Na+/H+ antiporter system interact with other cellular processes during stress responses?

The S. aureus Na+/H+ antiporter system is intimately connected with various cellular stress responses. Research has revealed a significant link between Na+/H+ antiporters and nitric oxide (NO·) resistance . A transposon screen identified 168 genes essential for full NO· resistance in S. aureus USA300 LAC strain, including genes encoding Na+/H+ antiporters . This resistance mechanism is connected to the maintenance of cytosolic pH, as S. aureus NO· resistance requires a mildly alkaline cytosol . The antiporter likely works in concert with the F1F0 ATPase, which operates in ATP-hydrolysis mode to extrude protons and contribute to proton-motive force . This coordinated activity helps maintain appropriate cytosolic pH during nitrosative stress.

What is the evolutionary significance of the multisubunit architecture of the S. aureus Na+/H+ antiporter?

The S. aureus Na+/H+ antiporter represents a novel type of multisubunit Na+/H+ antiporter . This complex architecture suggests evolutionary adaptations that may provide advantages in terms of regulation, substrate specificity, or functional versatility. Sequence similarity between antiporter subunits and components of the respiratory chain indicates possible evolutionary relationships or functional convergence . The multisubunit architecture may allow for fine-tuned responses to various environmental conditions, potentially contributing to S. aureus' remarkable adaptability and pathogenicity. Further comparative genomic analyses across different bacterial species could provide insights into the evolutionary trajectory of this complex antiporter system.

What are the optimal expression systems for producing recombinant S. aureus Na+/H+ antiporter subunit C1?

Based on available research data, E. coli has been successfully used as a host for expressing functional S. aureus Na+/H+ antiporter components . For recombinant production of Na+/H+ antiporter subunits, including subunit C1, expression systems that can accommodate membrane proteins are necessary. Commercially available recombinant antiporter subunits utilize E. coli, yeast, baculovirus, or mammalian cell expression systems . When designing expression systems for subunit C1, researchers should consider:

Expression SystemAdvantagesLimitationsOptimal For
E. coliHigh yield, simple cultureLimited post-translational modificationsStructural studies, antibody production
YeastEukaryotic processing, moderate yieldMore complex culture conditionsFunctional studies
BaculovirusHigh-level expression, eukaryotic PTMsTechnical complexity, costComplex protein studies
MammalianNative-like processingLow yield, highest costInteraction studies

For functional studies, co-expression of multiple or all antiporter subunits may be necessary, as the seven subunits work together as a functional unit .

What techniques are most effective for assessing Na+/H+ antiporter function in experimental systems?

Several complementary techniques can be employed to assess Na+/H+ antiporter function:

  • Growth complementation assays: Using E. coli mutants lacking Na+/H+ antiporters as hosts and assessing growth restoration in high salt (0.2 M NaCl) or alkaline conditions .

  • Membrane vesicle assays: Preparing membrane vesicles from transformants and directly measuring Na+/H+ antiport activity through ion flux assays .

  • Fluorescent probes: Employing pH-sensitive or Na+-sensitive fluorescent probes to monitor real-time changes in ion concentrations.

  • Radioisotope flux measurements: Using 22Na+ to track sodium movement across membranes.

  • Respiration-driven Na+ extrusion assays: Measuring Na+ extrusion activity in the presence of respiratory substrates and specific inhibitors .

The sensitivity to H+ conductors can be used to distinguish between true Na+/H+ antiporters and respiratory Na+ pumps .

How can researchers effectively purify and stabilize recombinant Na+/H+ antiporter subunit C1 for structural studies?

Purification and stabilization of membrane proteins like Na+/H+ antiporter subunit C1 present significant challenges. Based on research practices with similar membrane proteins:

  • Detergent selection: Screen multiple detergents (DDM, LMNG, CHAPS) for optimal extraction while maintaining protein stability and function.

  • Affinity tags: Incorporate His6 or other affinity tags for initial purification, with optional protease cleavage sites for tag removal.

  • Size exclusion chromatography: Use as a final purification step to ensure homogeneity and remove aggregates.

  • Stability screening: Employ differential scanning fluorimetry to identify buffer conditions that maximize protein stability.

  • Lipid supplementation: Add specific phospholipids during purification to maintain native-like environment.

For storage, purified recombinant antiporter subunits should be maintained in glycerol-containing buffer at -20°C or -80°C for extended stability .

How does subunit C1 contribute to S. aureus pathogenesis and antibiotic resistance?

While the direct role of subunit C1 in pathogenesis isn't explicitly detailed in the provided research, the Na+/H+ antiporter system as a whole contributes significantly to S. aureus virulence. The antiporter system enables adaptation to host environments by:

  • pH homeostasis: Maintaining appropriate intracellular pH despite environmental fluctuations, particularly important as S. aureus NO· resistance requires a mildly alkaline cytosol .

  • Osmotic stress management: Allowing growth in varying salt concentrations encountered in different host niches .

  • Nitrosative stress resistance: Na+/H+ antiporters have been identified in screens for genes essential for NO· resistance . Since NO· is a key immune effector produced by host cells, this resistance mechanism significantly impacts pathogenesis.

  • Metabolic adaptation: Contributing to the metabolic flexibility that allows S. aureus to thrive under various growth-limiting conditions, including those imposed by antibiotic treatment .

Disruption of antiporter function could potentially sensitize S. aureus to host defense mechanisms and certain antibiotics, making it a potential target for novel therapeutic approaches.

What insights have mutagenesis studies provided about critical residues in subunit C1?

The search results don't specifically detail mutagenesis studies on subunit C1, but research on the Na+/H+ antiporter system provides a framework for understanding the importance of specific subunits. Deletion studies of the related antiporter components nhaC and SAUSA300_0617 have shown:

  • Deletion of SAUSA300_0617 resulted in slowed but not completely inhibited growth in the presence of NO·, with growth inhibition becoming more pronounced at higher NO· concentrations .

  • This indicates that while individual antiporter components contribute to stress resistance, there may be functional redundancy or compensatory mechanisms within the system.

Based on studies of similar antiporter systems, critical residues in subunit C1 likely include:

  • Charged residues in transmembrane domains that participate in ion coordination

  • Conserved motifs involved in conformational changes during the transport cycle

  • Residues at subunit interfaces that enable proper assembly of the multisubunit complex

How can the S. aureus Na+/H+ antiporter system be targeted for therapeutic development?

The multisubunit Na+/H+ antiporter represents a potential target for novel antimicrobial development, particularly given its role in stress resistance and pathogenesis. Therapeutic strategies could include:

  • Small molecule inhibitors: Compounds that specifically disrupt antiporter function could sensitize S. aureus to host defense mechanisms and certain antibiotics.

  • Peptide inhibitors: Designed to interfere with critical subunit-subunit interactions necessary for antiporter assembly or function.

  • Combination approaches: Using antiporter inhibitors to potentiate the effects of existing antibiotics or host defense mechanisms.

The potential of Na+/H+ antiporters as drug targets is supported by research showing their importance during nitrosative stress and pH/salt stress conditions . The fact that multiple deletion mutants of antiporter components display growth defects under stress conditions suggests that targeting this system could effectively compromise S. aureus virulence and survival within hosts.

What are the major challenges in expressing and purifying functional recombinant S. aureus Na+/H+ antiporter subunits?

Researchers face several significant challenges when working with Na+/H+ antiporter subunits:

  • Membrane protein solubility: The hydrophobic nature of all seven antiporter subunits makes them challenging to solubilize while maintaining native structure and function .

  • Functional reconstitution: As a multisubunit complex, the functional antiporter requires proper assembly of multiple components. When studying individual subunits like C1, researchers must consider how to evaluate its properties in isolation versus as part of the complete complex .

  • Expression toxicity: Overexpression of membrane proteins often leads to toxicity in host cells, requiring careful optimization of induction conditions and expression levels.

  • Protein stability: Maintaining stability during purification and subsequent experiments is particularly challenging for membrane proteins. Commercially available recombinant antiporter subunits are typically stored with glycerol at -20°C for stability .

  • Functional assays: Developing reliable assays to confirm that recombinantly produced proteins retain native activity, particularly when working with individual subunits of a multicomponent system.

How can researchers effectively analyze the interaction between subunit C1 and other components of the antiporter complex?

Several complementary approaches can be employed to study subunit interactions:

  • Co-immunoprecipitation: Using antibodies against one subunit to pull down interacting partners, which can then be identified by mass spectrometry or Western blotting.

  • Crosslinking studies: Chemical crosslinkers can capture transient interactions between subunits, with crosslinked products analyzed by mass spectrometry to identify interaction interfaces.

  • Fluorescence resonance energy transfer (FRET): Tagging different subunits with fluorescent proteins to monitor their proximity and interaction in real-time.

  • Two-hybrid membrane protein interaction systems: Specialized yeast or bacterial two-hybrid systems adapted for membrane protein interaction studies.

  • Cryo-electron microscopy: For structural characterization of the assembled complex, potentially revealing the spatial arrangement and interaction interfaces of all subunits.

When designing such experiments, researchers should consider that the seven ORFs of the antiporter form an operon, suggesting coordinated expression and potential interdependence for proper folding or function .

What are the most promising directions for future research on S. aureus Na+/H+ antiporter subunit C1?

  • Structural biology: Determining high-resolution structures of individual subunits and the assembled complex would provide invaluable insights into the mechanism of ion transport and subunit interactions.

  • Host-pathogen interactions: Further investigating how the antiporter system contributes to survival within different host niches and resistance to host defense mechanisms.

  • Regulatory networks: Exploring how expression and activity of the antiporter system are regulated in response to environmental changes and stress conditions.

  • Drug discovery: Screening for small molecules that specifically inhibit the antiporter function, potentially leading to novel therapeutic approaches.

  • Systems biology: Integrating antiporter function into comprehensive models of S. aureus metabolism and stress responses to understand its role in the broader cellular context.

The connection between Na+/H+ antiporters and nitric oxide resistance represents a particularly promising avenue, as it links this transport system directly to host-pathogen interactions and virulence .

How does the S. aureus Na+/H+ antiporter system compare to analogous systems in other pathogens?

The S. aureus Na+/H+ antiporter represents a novel type of multisubunit antiporter . Comparative analysis with other bacterial systems could reveal:

  • Evolutionary relationships: How this seven-subunit architecture evolved and whether it represents a unique adaptation in S. aureus or is shared with closely related species.

  • Functional specialization: Whether the multisubunit nature provides functional advantages compared to simpler antiporter systems in other bacteria.

  • Therapeutic implications: If the unique features of the S. aureus system could be exploited for species-specific antimicrobial development.

The research indicating sequence similarity between antiporter subunits and components of the respiratory chain suggests interesting evolutionary relationships that merit further investigation . Understanding these relationships could provide insights into the functional integration of different membrane transport and energy transduction systems in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.