Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit C1 (mnhC1)

Structural Characteristics of mnhC1

Q: What is the amino acid composition and structural characteristics of Staphylococcus aureus Na(+)/H(+) antiporter subunit C1?

A: The mnhC1 protein consists of 113 amino acids with the sequence: MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD. This protein is classified as a membrane protein component of the Na(+)/H(+) antiporter complex in Staphylococcus aureus strain MSSA476, with Uniprot accession number Q6GAX6. When designing experiments to characterize this protein, researchers should consider its transmembrane domains and hydrophobic regions, which influence solubility and folding properties during recombinant expression. Structural studies would typically require techniques such as X-ray crystallography (requiring 5-10 mg of purified, crystallized protein) or NMR spectroscopy (requiring 2-30 mg of purified protein) .

Q: How should researchers approach experimental validation of mnhC1's predicted transmembrane topology?

A: When experimentally validating the transmembrane topology of mnhC1, researchers should implement a multi-method approach. Begin with computational prediction using algorithms like TMHMM, MEMSAT, or TOPCONS to establish baseline models. Follow with biochemical validation using techniques such as cysteine scanning mutagenesis, where single cysteines are introduced throughout the sequence and their accessibility to membrane-impermeable reagents is assessed. Epitope tagging combined with protease protection assays can determine which regions face the cytoplasm versus periplasm. For higher resolution data, employ cross-linking mass spectrometry (XL-MS) to identify spatial proximities between amino acids. These approaches should be conducted using properly folded recombinant mnhC1 in appropriate membrane mimetics (detergents or lipid nanodiscs). Correlate experimental findings with phenotypic data from functional assays to ensure the structural model explains observed ion transport activities.

Expression and Purification Methodologies

Q: What expression systems are most appropriate for producing functional recombinant mnhC1 protein for structural studies?

A: For expressing functional recombinant mnhC1, researchers should consider the protein's membrane-associated nature. E. coli-based expression systems using specialized strains (C41/C43, Lemo21) designed for membrane proteins generally offer high yields. Expression vectors should incorporate affinity tags (His6, FLAG) positioned to avoid interfering with transmembrane domains. Expression must be carefully optimized - typical conditions include induction at lower temperatures (16-20°C) with reduced inducer concentrations, which promotes proper folding. For more native-like folding, consider eukaryotic systems such as Pichia pastoris or insect cell expression, particularly if bacterial expression yields improperly folded protein. Each preparation should be validated for functionality using ion transport assays before proceeding to structural studies. The expression region spans residues 1-113 as indicated in the protein specifications, which should be considered when designing constructs .

Q: What purification strategy would yield the highest purity and stability for recombinant mnhC1 protein?

A: Purifying recombinant mnhC1 protein requires a carefully designed strategy to maintain stability and functional integrity. Begin with gentle cell lysis using specialized detergents (DDM, LMNG, or C12E8) that effectively solubilize membrane proteins while preserving native conformation. Implement a multi-step purification approach starting with immobilized metal affinity chromatography (IMAC) utilizing the affinity tag incorporated during expression. Follow with size exclusion chromatography to separate monomeric protein from aggregates and remove remaining contaminants. If higher purity is required, incorporate an intermediate ion exchange chromatography step. Throughout purification, maintain a stabilizing buffer containing appropriate detergent concentrations, glycerol (20-50%), and specific ions relevant to protein function. Quality assessment should include SDS-PAGE, Western blotting, and dynamic light scattering to verify purity, identity, and monodispersity. For long-term storage, flash-freeze aliquots and store at -80°C in a buffer optimized for this specific protein to prevent activity loss .

Functional Characterization Techniques

Q: What methodological approaches can effectively measure the ion transport activity of purified recombinant mnhC1?

A: To measure ion transport activity of recombinant mnhC1, researchers should implement a comprehensive suite of functional assays. Begin by reconstituting the purified protein into proteoliposomes containing fluorescent indicators sensitive to Na⁺ (SBFI) or H⁺ (BCECF). Monitor fluorescence changes in response to imposed ion gradients using stopped-flow spectroscopy for kinetic measurements. Complementary electrophysiological approaches include solid-supported membrane (SSM)-based electrophysiology, which can detect charge movements associated with antiporter activity. For in-depth mechanistic studies, incorporate site-directed mutagenesis of conserved residues predicted to participate in ion binding or translocation, then compare transport kinetics of mutants to wild-type protein. Isothermal titration calorimetry can provide thermodynamic parameters of ion binding. When analyzing data, fit transport rates to appropriate kinetic models (sequential binding, ping-pong mechanisms) to determine kinetic constants and transport stoichiometry. These approaches collectively provide a comprehensive assessment of mnhC1's contribution to Na⁺/H⁺ exchange activity.

Q: How can researchers distinguish between the roles of mnhC1 and other subunits in the complete Na(+)/H(+) antiporter complex?

Structural Analysis Approaches

Q: What techniques should be employed to resolve potential discrepancies in structural data obtained from different methodologies for mnhC1?

A: When addressing discrepancies in structural data for mnhC1 from different methodologies, researchers should implement a systematic reconciliation approach. Begin by evaluating each technique's limitations - X-ray crystallography may introduce crystal packing artifacts, while NMR might have distance constraint ambiguities, and cryo-EM reconstructions could suffer from flexibility issues. Perform molecular dynamics simulations using each structural model in a lipid bilayer environment to test stability and conformational dynamics. Apply cross-validation using orthogonal experimental techniques; for instance, use site-directed spin labeling and electron paramagnetic resonance (EPR) to measure distances between specific residues and compare with predictions from each model. Hydrogen-deuterium exchange mass spectrometry can verify solvent accessibility patterns. For functional validation, design mutagenesis experiments targeting residues that show structural differences between models and assess impact on transport activity. Statistical analysis should quantify agreement between models using metrics such as RMSD for backbone atoms while focusing on functionally relevant regions. Present a consensus model that incorporates the highest confidence elements from each technique, explicitly acknowledging regions of uncertainty .

Controls and Validation Methods

Q: What controls should be incorporated when using recombinant mnhC1 protein in Western blot experiments?

A: When using recombinant mnhC1 in Western blot experiments, a comprehensive control strategy is essential. Include positive controls using purified recombinant mnhC1 protein at known concentrations to establish detection sensitivity and antibody specificity. This control also verifies the expected migration pattern, which may differ from the theoretical molecular weight calculation. Include negative controls such as samples from mnhC1 knockout strains or unrelated membrane proteins to confirm antibody specificity. For loading controls, use antibodies against constitutively expressed membrane proteins of S. aureus. When examining expression under different conditions, normalize band intensities to these loading controls using quantitative image analysis. Include a molecular weight marker spanning the expected size range of mnhC1. For studying protein complexes, perform parallel native PAGE alongside SDS-PAGE. When analyzing post-translational modifications, include appropriate enzymatic treatments (phosphatases, glycosidases) as controls. Technical replicates across multiple blots are necessary for statistical validation, while biological replicates from independent cultures ensure reproducibility of physiological observations .

Q: How should researchers design appropriate ELISA protocols to quantify mnhC1 expression levels in different bacterial growth conditions?

A: Designing a robust ELISA protocol for quantifying mnhC1 expression requires meticulous attention to specificity and calibration. Begin by developing or obtaining highly specific antibodies against mnhC1, preferably targeting epitopes accessible in the native protein conformation. For calibration, prepare a standard curve using purified recombinant mnhC1 protein quantified by BCA assay, with concentrations ranging from 0.1-100 ng/mL to establish the detection range. When preparing bacterial samples from different growth conditions, standardize the extraction protocol to ensure consistent membrane protein solubilization using appropriate detergents like DDM or CHAPS at concentrations optimized to maintain protein structure while preventing assay interference. Implement a sandwich ELISA format with capture antibodies specific to conserved regions of mnhC1 and detection antibodies targeting distinct epitopes. For each experimental condition, analyze multiple biological replicates (n≥3) with technical triplicates. Include controls for antibody cross-reactivity using samples from mnhC1 knockout strains. Normalize expression data to total membrane protein content or to a constitutively expressed membrane protein measured in parallel ELISAs. Statistical analysis should include ANOVA with appropriate post-hoc tests when comparing multiple growth conditions .

Data Analysis Frameworks

Q: What statistical approaches are most appropriate for analyzing ion transport kinetics data obtained from recombinant mnhC1 experiments?

A: When analyzing ion transport kinetics data from recombinant mnhC1 experiments, researchers should implement a multi-tiered statistical framework. Begin with data preprocessing, including outlier detection using Grubb's test and normalization to account for variation in proteoliposome preparation or protein incorporation efficiency. For steady-state kinetics, fit data to appropriate models (Michaelis-Menten, Hill equation) using non-linear regression analysis, extracting parameters such as Vmax, Km, and Hill coefficients with 95% confidence intervals. For comparing kinetic parameters across experimental conditions, apply ANOVA followed by appropriate post-hoc tests (Tukey's HSD for multiple comparisons). When analyzing time-course data, use regression analysis or exponential fitting to determine rate constants. For complex kinetic schemes involving multiple steps, employ global fitting strategies that simultaneously analyze multiple datasets with shared parameters. Utilize information criteria (AIC, BIC) to select the most parsimonious model that adequately explains the data. Report effect sizes alongside p-values to indicate biological significance. Visualize data using residual plots to verify model assumptions and prepare clear graphical representations including error bars representing standard deviation or standard error as appropriate .

Q: How should researchers reconcile conflicting data regarding mnhC1's role in antibiotic resistance mechanisms?

A: When reconciling conflicting data about mnhC1's role in antibiotic resistance, implement a systematic meta-analytical approach. First, create a comprehensive table documenting all experimental parameters from conflicting studies, including bacterial strains, growth conditions, antibiotic concentrations, and experimental endpoints. Identify potential sources of variation such as differences in genetic background, measurement techniques, or environmental factors. Design validation experiments that specifically address these variables, incorporating appropriate controls and sufficient replication (n≥6 biological replicates) to achieve adequate statistical power. Perform dose-response experiments across a wide concentration range rather than single-point measurements. For mechanistic understanding, combine genetic approaches (gene deletion, complementation, site-directed mutagenesis) with direct measurement of antibiotic accumulation and membrane potential. Consider potential indirect effects by measuring expression of other resistance determinants in mnhC1 mutants. Apply statistical methods such as two-way ANOVA to assess interaction effects between mnhC1 status and experimental conditions. Present findings as forest plots to visualize effect sizes across different experimental paradigms. This comprehensive approach will help distinguish direct contributions of mnhC1 to resistance from context-dependent or indirect effects .

Integration with Systems Biology Approaches

Q: How can researchers integrate mnhC1 functional data with broader systems biology studies of Staphylococcus aureus?

A: Integrating mnhC1 functional data with systems biology approaches requires a multi-omics strategy. Begin by performing RNA-Seq analysis comparing wild-type and mnhC1 mutant strains under various stress conditions to identify compensatory transcriptional responses and co-regulated genes. Complement this with proteomics profiling using techniques such as SILAC or TMT labeling to quantify protein-level changes. Construct protein-protein interaction networks through affinity purification-mass spectrometry (AP-MS) with tagged mnhC1 to identify physical interactors. Apply metabolomics to quantify changes in ion concentrations, pH, and energy metabolism parameters. Integrate these datasets using computational approaches such as weighted gene correlation network analysis (WGCNA) or Bayesian network inference to identify functional modules connected to mnhC1 activity. For phenotypic integration, conduct genome-wide synthetic genetic array analyses to identify genes with epistatic relationships to mnhC1. Develop mathematical models simulating ion homeostasis incorporating experimentally determined kinetic parameters from recombinant protein studies. Validate model predictions through targeted experimental interventions. This integrated approach will position mnhC1 function within the broader context of S. aureus physiology and pathogenesis, potentially revealing unexpected roles and regulatory connections .

Q: What methodological approaches can link mnhC1 function to Staphylococcus aureus virulence in experimental infection models?

A: To establish the relationship between mnhC1 function and S. aureus virulence, researchers should implement a comprehensive host-pathogen interaction framework. Begin with comparative virulence studies using isogenic wild-type, mnhC1 deletion, and complemented strains in multiple infection models (invertebrate, murine systemic, skin/soft tissue, and biofilm infections). Quantify bacterial burden, dissemination, and host survival rates. Apply tissue-specific transcriptomics to bacteria recovered from different infection sites to measure mnhC1 expression in vivo. For mechanistic insights, engineer strains with mnhC1 mutations affecting specific functional properties (ion selectivity, transport rates) and assess their virulence phenotypes. Measure the impact of mnhC1 function on key virulence determinants including toxin production, immune evasion factors, and biofilm formation using quantitative assays. To understand host response effects, perform dual RNA-Seq on infected tissues to simultaneously capture host and pathogen transcriptional changes. Use intravital microscopy with fluorescently labeled bacteria to visualize infection dynamics in real-time. Employ neutrophil killing assays to assess whether mnhC1 contributes to phagocyte resistance. These approaches collectively will establish whether and how mnhC1-mediated ion homeostasis contributes to S. aureus pathogenesis in different host environments .

Comparative Analysis with Other Bacterial Species

Q: How should researchers design experiments to compare the function of S. aureus mnhC1 with homologous proteins from other pathogenic bacteria?

A: Designing comparative experiments for S. aureus mnhC1 and homologs from other bacterial species requires a structured approach addressing both sequence-function relationships and physiological contexts. Begin with comprehensive bioinformatic analysis using tools like HMMER and BLAST to identify true homologs, followed by multiple sequence alignment and phylogenetic reconstruction to establish evolutionary relationships. Create a standardized expression system where all homologs are cloned with identical tags in the same vector backbone, enabling fair comparison of expression levels and purification yields. Purify each protein using identical protocols and reconstitute into liposomes of defined composition for functional studies. Implement parallel measurement of transport kinetics, ion selectivity, and pH dependence using fluorescence-based assays under identical conditions. For in vivo comparison, perform complementation studies where each homolog is expressed in a mnhC1-deficient S. aureus strain, followed by comprehensive phenotypic characterization including growth curves under various stress conditions, antibiotic susceptibility testing, and virulence factor production. Apply statistical approaches such as principal component analysis to identify patterns in functional parameters across homologs. This systematic comparison will reveal conserved and divergent functional properties that can be correlated with bacterial lifestyle and pathogenic potential.

Methodological Approaches for Drug Discovery

Q: What experimental screening approaches can identify potential inhibitors targeting the recombinant mnhC1 protein?

A: Developing a robust inhibitor screening pipeline for mnhC1 requires a multi-stage approach. Begin with in silico screening by constructing a high-quality homology model of mnhC1 based on structurally characterized antiporter homologs, followed by virtual screening of compound libraries targeting predicted ion binding sites or conformational transition points. Progress to biochemical screening using purified recombinant mnhC1 reconstituted in proteoliposomes or nanodiscs with fluorescent ion indicators to measure transport inhibition in a high-throughput format. Develop a quantitative assay protocol with Z' factor >0.5 to ensure statistical reliability. Counter-screen hits against mammalian Na⁺/H⁺ exchangers to identify selective inhibitors. For hit validation, determine IC50 values and mechanism of inhibition (competitive, non-competitive) through detailed kinetic analysis. Assess membrane integrity during compound exposure to eliminate false positives that act as ionophores. Progress to cellular assays using wild-type and mnhC1-overexpressing S. aureus strains to confirm target engagement in biological context. For advanced candidates, perform structural studies (X-ray, cryo-EM) of mnhC1-inhibitor complexes to guide structure-based optimization. This systematic approach will yield well-characterized lead compounds with defined mechanisms of action against this potential antimicrobial target .

Q: How can researchers evaluate whether inhibition of mnhC1 function potentiates existing antibiotic treatments against Staphylococcus aureus?

A: To evaluate mnhC1 inhibition as an antibiotic potentiator, implement a systematic combination therapy assessment framework. Begin with checkerboard assays across a matrix of mnhC1 inhibitor concentrations and various antibiotics to calculate fractional inhibitory concentration indices (FICI), identifying synergistic (FICI ≤0.5), additive (FICI >0.5-1.0), or antagonistic (FICI >4.0) interactions. Verify findings with time-kill kinetics measuring bacterial survival over 24 hours during combination treatment. To establish specificity, perform identical experiments with mnhC1-deleted strains, where true on-target potentiation should show no synergy. Assess impact on resistance development through serial passage experiments comparing mutation frequency and resistance stability in single versus combination therapy. Mechanistically, measure antibiotic accumulation using fluorescent derivatives or LC-MS/MS quantification to determine if mnhC1 inhibition enhances drug uptake. Examine effects on membrane potential and pH homeostasis using appropriate fluorescent probes. For translation potential, evaluate combination efficacy in biofilm models and infected primary human cells. Test promising combinations in murine infection models, measuring bacterial burden, inflammatory markers, and tissue damage. This comprehensive approach will determine whether mnhC1 represents a viable target for antibiotic adjuvant therapy against resistant S. aureus infections .