Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit C1 (mnhC1)

Shipped with Ice Packs
In Stock

Description

Multisubunit Composition

Staphylococcus aureus possesses three types of cation/proton antiporters, with the type 3 family including two multisubunit Na(+)/H(+) antiporters designated as Mnh1 and Mnh2 . These sophisticated molecular machines are characterized by clusters of seven hydrophobic membrane-bound protein subunits that form functional complexes embedded within the bacterial cell membrane . Each subunit contributes specific structural elements essential for the coordinated transport of ions across the membrane barrier.

Genetic Organization

The genes encoding the Mnh antiporter subunits are organized in an operon structure. Research has confirmed that seven open reading frames (ORFs) are necessary and sufficient for Na(+)/H(+) antiporter function in S. aureus . The mnh operon contains genes designated mnhA through mnhG, with each gene encoding a distinct subunit of the antiporter complex . The mnhC1 gene specifically encodes the C1 subunit of the Mnh1 antiporter system, representing one of the critical components within this multisubunit complex.

Analysis of the genetic organization reveals a promoter-like sequence in the upstream region of the mnh operon, while an inverted repeat followed by a T-cluster, potentially functioning as a terminator, has been identified in the downstream region . The absence of terminator-like or promoter-like sequences between the seven ORFs strongly suggests that these genes comprise a single operon and are co-transcribed .

Ion Exchange Mechanisms

The Mnh antiporters in S. aureus play crucial roles in maintaining cytoplasmic pH, thereby enabling bacterial survival under extreme environmental conditions . These membrane transport systems catalyze the exchange of cations (primarily Na+ and H+) across the cell membrane.

Experimental studies using everted (inside out) vesicles have demonstrated distinct ion exchange properties between the Mnh1 and Mnh2 antiporters. The Mnh1 antiporter, which contains the mnhC1 subunit, exhibits significant exchange activity specific for Na+/H+ cations, with optimal functionality at pH 7.5 . This specialized ion exchange mechanism allows S. aureus to maintain appropriate intracellular sodium concentrations while regulating cytoplasmic pH.

pH-Dependent Activity

A notable characteristic of the Mnh antiporters is their pH-dependent activity. Experimental evidence indicates that the Mnh1 antiporter, which includes mnhC1, demonstrates optimal Na+/H+ exchange at pH 7.5, while the Mnh2 antiporter functions most efficiently at pH 8.5 . This differential pH dependency suggests specialized roles for each antiporter system in maintaining bacterial homeostasis across varying environmental pH conditions.

The pH-dependent activity profiles of these antiporters are consistent with their proposed physiological roles in bacterial adaptation to alkaline conditions. As external pH increases, the activities of these antiporters become increasingly important for maintaining appropriate cytoplasmic pH and ion balance .

Salt and Alkali Tolerance

The Mnh antiporters play essential roles in conferring salt and alkali tolerance to S. aureus. Under elevated salt conditions, deletion of the mnhA1 gene results in a significant reduction in bacterial growth rate, particularly in the pH range of 7.5 to 9.0 . This finding underscores the critical contribution of the Mnh1 system, including the mnhC1 subunit, to halotolerance in slightly alkaline environments.

Similarly, deletion of mnhA2 impacts bacterial growth, albeit predominantly within a higher pH range of 8.5 to 9.5 . Most notably, simultaneous deletion of both mnhA1 and mnhA2 leads to severe growth impairment at pH values above 8.5, highlighting the complementary yet distinct roles of these antiporter systems in alkali tolerance .

Contribution to Virulence

Beyond their roles in environmental adaptation, the Mnh antiporters significantly impact S. aureus virulence. In vivo infection models using mice have revealed that deletion of the mnhA1 gene results in a major loss of S. aureus virulence, whereas deletion of mnh2 does not alter virulence capabilities . This finding strongly suggests that the Mnh1 system, which includes the mnhC1 subunit, plays a crucial role in pathogenesis, potentially by facilitating bacterial adaptation to host environments.

The observed connection between the Mnh1 antiporter and virulence highlights the potential significance of mnhC1 as a target for antimicrobial strategies. By disrupting the function of this critical subunit, it may be possible to attenuate bacterial virulence and enhance host immune clearance of the pathogen.

Expression Systems and Methodologies

Recombinant expression of mnhC1 has proven essential for studying the structure and function of this critical antiporter subunit. Researchers have successfully cloned the Mnh1 antiporter genes, including mnhC1, into vectors such as pGEM3Z+ for expression in antiporter-deficient Escherichia coli strains . This approach has enabled detailed analysis of the catalytic properties and physiological roles of the Mnh1 antiporter complex.

The expression of recombinant mnhC1 within the context of the complete Mnh1 antiporter system has been crucial for maintaining functional integrity. Studies have demonstrated that the seven subunits of the Mnh antiporter operate coordinately, with all components necessary for full functional activity .

Functional Characterization

Functional characterization of recombinant mnhC1 as part of the Mnh1 antiporter has been accomplished using everted membrane vesicles prepared from E. coli transformants . This experimental approach has enabled detailed measurement of Na+/H+ exchange activity under various pH conditions and ion concentrations.

The recombinant expression of mnhC1 within the complete Mnh1 system has confirmed its essential role in mediating Na+/H+ exchange at physiological pH ranges. These functional studies have provided valuable insights into the catalytic properties of the antiporter and its contribution to bacterial pH homeostasis.

Substrate Specificity

A comparative analysis of the Mnh1 and Mnh2 antiporters reveals distinct patterns of substrate specificity. The Mnh1 antiporter, which includes mnhC1, exhibits significant Na+/H+ exchange activity but shows limited capacity for K+/H+ exchange . In contrast, the Mnh2 antiporter demonstrates substantial exchange activity for both Na+/H+ and K+/H+ cations .

These differences in substrate specificity reflect the specialized physiological roles of each antiporter system. The Mnh1 antiporter (containing mnhC1) appears primarily dedicated to Na+ homeostasis, while the Mnh2 system contributes to both Na+ and K+ regulation within S. aureus cells.

pH Optima and Physiological Implications

The distinct pH optima of the Mnh1 and Mnh2 antiporters suggest complementary roles in bacterial adaptation to varying environmental conditions. The Mnh1 antiporter functions optimally at pH 7.5, whereas the Mnh2 system demonstrates peak activity at pH 8.5 . This pH-dependent specialization enables S. aureus to maintain ion homeostasis across a broad range of external pH values.

The physiological significance of these differences is evident in growth studies using deletion mutants. Deletion of mnhA1 (affecting the Mnh1 system including mnhC1) primarily impacts growth at moderate alkaline conditions (pH 7.5-9.0), while deletion of mnhA2 affects growth at higher pH values (pH 8.5-9.5) . This complementary pH dependency highlights the sophisticated adaptation mechanisms that have evolved in S. aureus.

Maintenance of Cytoplasmic pH

The mnhC1 subunit, as part of the Mnh1 antiporter system, plays a crucial role in maintaining cytoplasmic pH in S. aureus. By facilitating the exchange of Na+ and H+ ions across the cell membrane, this antiporter contributes to the proton motive force and helps regulate intracellular pH under various environmental conditions .

The ability to maintain appropriate cytoplasmic pH is particularly important during exposure to alkaline environments or high salt concentrations. Under these challenging conditions, the Mnh1 antiporter system becomes essential for bacterial survival and growth .

Contribution to Virulence Mechanisms

The significant reduction in virulence observed in mnhA1 deletion mutants underscores the importance of the Mnh1 antiporter system, including mnhC1, in S. aureus pathogenesis . The precise mechanisms by which this antiporter contributes to virulence remain to be fully elucidated, but several possibilities exist.

The Mnh1 antiporter may enhance bacterial survival within the host by maintaining appropriate cytoplasmic pH and ion balance in response to host defense mechanisms. Additionally, the antiporter might facilitate adaptation to specific host niches characterized by unique pH or salt conditions. Understanding these virulence mechanisms could potentially reveal new targets for antimicrobial therapies.

Therapeutic Potential

Given the established connection between the Mnh1 antiporter and S. aureus virulence, targeting mnhC1 represents a promising approach for developing novel antimicrobial strategies. Compounds that specifically inhibit mnhC1 function could potentially attenuate bacterial virulence without directly killing the pathogen, thereby reducing selective pressure for resistance development.

Further research into the structure-function relationships of mnhC1 could facilitate the rational design of specific inhibitors. Additionally, exploring the regulatory mechanisms controlling mnhC1 expression might reveal alternative strategies for modulating antiporter activity in therapeutic contexts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhC1; SAUSA300_0853; Na(+/H(+ antiporter subunit C1; Mnh complex subunit C1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Staphylococcus aureus (strain USA300)
Target Names
mnhC1
Target Protein Sequence
MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
Uniprot No.

Target Background

Function
Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion.
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Structural Characteristics of mnhC1

Q: What is the amino acid composition and structural characteristics of Staphylococcus aureus Na(+)/H(+) antiporter subunit C1?

A: The mnhC1 protein consists of 113 amino acids with the sequence: MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD. This protein is classified as a membrane protein component of the Na(+)/H(+) antiporter complex in Staphylococcus aureus strain MSSA476, with Uniprot accession number Q6GAX6. When designing experiments to characterize this protein, researchers should consider its transmembrane domains and hydrophobic regions, which influence solubility and folding properties during recombinant expression. Structural studies would typically require techniques such as X-ray crystallography (requiring 5-10 mg of purified, crystallized protein) or NMR spectroscopy (requiring 2-30 mg of purified protein) .

Q: How should researchers approach experimental validation of mnhC1's predicted transmembrane topology?

A: When experimentally validating the transmembrane topology of mnhC1, researchers should implement a multi-method approach. Begin with computational prediction using algorithms like TMHMM, MEMSAT, or TOPCONS to establish baseline models. Follow with biochemical validation using techniques such as cysteine scanning mutagenesis, where single cysteines are introduced throughout the sequence and their accessibility to membrane-impermeable reagents is assessed. Epitope tagging combined with protease protection assays can determine which regions face the cytoplasm versus periplasm. For higher resolution data, employ cross-linking mass spectrometry (XL-MS) to identify spatial proximities between amino acids. These approaches should be conducted using properly folded recombinant mnhC1 in appropriate membrane mimetics (detergents or lipid nanodiscs). Correlate experimental findings with phenotypic data from functional assays to ensure the structural model explains observed ion transport activities.

Expression and Purification Methodologies

Q: What expression systems are most appropriate for producing functional recombinant mnhC1 protein for structural studies?

A: For expressing functional recombinant mnhC1, researchers should consider the protein's membrane-associated nature. E. coli-based expression systems using specialized strains (C41/C43, Lemo21) designed for membrane proteins generally offer high yields. Expression vectors should incorporate affinity tags (His6, FLAG) positioned to avoid interfering with transmembrane domains. Expression must be carefully optimized - typical conditions include induction at lower temperatures (16-20°C) with reduced inducer concentrations, which promotes proper folding. For more native-like folding, consider eukaryotic systems such as Pichia pastoris or insect cell expression, particularly if bacterial expression yields improperly folded protein. Each preparation should be validated for functionality using ion transport assays before proceeding to structural studies. The expression region spans residues 1-113 as indicated in the protein specifications, which should be considered when designing constructs .

Q: What purification strategy would yield the highest purity and stability for recombinant mnhC1 protein?

A: Purifying recombinant mnhC1 protein requires a carefully designed strategy to maintain stability and functional integrity. Begin with gentle cell lysis using specialized detergents (DDM, LMNG, or C12E8) that effectively solubilize membrane proteins while preserving native conformation. Implement a multi-step purification approach starting with immobilized metal affinity chromatography (IMAC) utilizing the affinity tag incorporated during expression. Follow with size exclusion chromatography to separate monomeric protein from aggregates and remove remaining contaminants. If higher purity is required, incorporate an intermediate ion exchange chromatography step. Throughout purification, maintain a stabilizing buffer containing appropriate detergent concentrations, glycerol (20-50%), and specific ions relevant to protein function. Quality assessment should include SDS-PAGE, Western blotting, and dynamic light scattering to verify purity, identity, and monodispersity. For long-term storage, flash-freeze aliquots and store at -80°C in a buffer optimized for this specific protein to prevent activity loss .

Functional Characterization Techniques

Q: What methodological approaches can effectively measure the ion transport activity of purified recombinant mnhC1?

A: To measure ion transport activity of recombinant mnhC1, researchers should implement a comprehensive suite of functional assays. Begin by reconstituting the purified protein into proteoliposomes containing fluorescent indicators sensitive to Na⁺ (SBFI) or H⁺ (BCECF). Monitor fluorescence changes in response to imposed ion gradients using stopped-flow spectroscopy for kinetic measurements. Complementary electrophysiological approaches include solid-supported membrane (SSM)-based electrophysiology, which can detect charge movements associated with antiporter activity. For in-depth mechanistic studies, incorporate site-directed mutagenesis of conserved residues predicted to participate in ion binding or translocation, then compare transport kinetics of mutants to wild-type protein. Isothermal titration calorimetry can provide thermodynamic parameters of ion binding. When analyzing data, fit transport rates to appropriate kinetic models (sequential binding, ping-pong mechanisms) to determine kinetic constants and transport stoichiometry. These approaches collectively provide a comprehensive assessment of mnhC1's contribution to Na⁺/H⁺ exchange activity.

Q: How can researchers distinguish between the roles of mnhC1 and other subunits in the complete Na(+)/H(+) antiporter complex?

Structural Analysis Approaches

Q: What techniques should be employed to resolve potential discrepancies in structural data obtained from different methodologies for mnhC1?

A: When addressing discrepancies in structural data for mnhC1 from different methodologies, researchers should implement a systematic reconciliation approach. Begin by evaluating each technique's limitations - X-ray crystallography may introduce crystal packing artifacts, while NMR might have distance constraint ambiguities, and cryo-EM reconstructions could suffer from flexibility issues. Perform molecular dynamics simulations using each structural model in a lipid bilayer environment to test stability and conformational dynamics. Apply cross-validation using orthogonal experimental techniques; for instance, use site-directed spin labeling and electron paramagnetic resonance (EPR) to measure distances between specific residues and compare with predictions from each model. Hydrogen-deuterium exchange mass spectrometry can verify solvent accessibility patterns. For functional validation, design mutagenesis experiments targeting residues that show structural differences between models and assess impact on transport activity. Statistical analysis should quantify agreement between models using metrics such as RMSD for backbone atoms while focusing on functionally relevant regions. Present a consensus model that incorporates the highest confidence elements from each technique, explicitly acknowledging regions of uncertainty .

Controls and Validation Methods

Q: What controls should be incorporated when using recombinant mnhC1 protein in Western blot experiments?

A: When using recombinant mnhC1 in Western blot experiments, a comprehensive control strategy is essential. Include positive controls using purified recombinant mnhC1 protein at known concentrations to establish detection sensitivity and antibody specificity. This control also verifies the expected migration pattern, which may differ from the theoretical molecular weight calculation. Include negative controls such as samples from mnhC1 knockout strains or unrelated membrane proteins to confirm antibody specificity. For loading controls, use antibodies against constitutively expressed membrane proteins of S. aureus. When examining expression under different conditions, normalize band intensities to these loading controls using quantitative image analysis. Include a molecular weight marker spanning the expected size range of mnhC1. For studying protein complexes, perform parallel native PAGE alongside SDS-PAGE. When analyzing post-translational modifications, include appropriate enzymatic treatments (phosphatases, glycosidases) as controls. Technical replicates across multiple blots are necessary for statistical validation, while biological replicates from independent cultures ensure reproducibility of physiological observations .

Q: How should researchers design appropriate ELISA protocols to quantify mnhC1 expression levels in different bacterial growth conditions?

A: Designing a robust ELISA protocol for quantifying mnhC1 expression requires meticulous attention to specificity and calibration. Begin by developing or obtaining highly specific antibodies against mnhC1, preferably targeting epitopes accessible in the native protein conformation. For calibration, prepare a standard curve using purified recombinant mnhC1 protein quantified by BCA assay, with concentrations ranging from 0.1-100 ng/mL to establish the detection range. When preparing bacterial samples from different growth conditions, standardize the extraction protocol to ensure consistent membrane protein solubilization using appropriate detergents like DDM or CHAPS at concentrations optimized to maintain protein structure while preventing assay interference. Implement a sandwich ELISA format with capture antibodies specific to conserved regions of mnhC1 and detection antibodies targeting distinct epitopes. For each experimental condition, analyze multiple biological replicates (n≥3) with technical triplicates. Include controls for antibody cross-reactivity using samples from mnhC1 knockout strains. Normalize expression data to total membrane protein content or to a constitutively expressed membrane protein measured in parallel ELISAs. Statistical analysis should include ANOVA with appropriate post-hoc tests when comparing multiple growth conditions .

Data Analysis Frameworks

Q: What statistical approaches are most appropriate for analyzing ion transport kinetics data obtained from recombinant mnhC1 experiments?

A: When analyzing ion transport kinetics data from recombinant mnhC1 experiments, researchers should implement a multi-tiered statistical framework. Begin with data preprocessing, including outlier detection using Grubb's test and normalization to account for variation in proteoliposome preparation or protein incorporation efficiency. For steady-state kinetics, fit data to appropriate models (Michaelis-Menten, Hill equation) using non-linear regression analysis, extracting parameters such as Vmax, Km, and Hill coefficients with 95% confidence intervals. For comparing kinetic parameters across experimental conditions, apply ANOVA followed by appropriate post-hoc tests (Tukey's HSD for multiple comparisons). When analyzing time-course data, use regression analysis or exponential fitting to determine rate constants. For complex kinetic schemes involving multiple steps, employ global fitting strategies that simultaneously analyze multiple datasets with shared parameters. Utilize information criteria (AIC, BIC) to select the most parsimonious model that adequately explains the data. Report effect sizes alongside p-values to indicate biological significance. Visualize data using residual plots to verify model assumptions and prepare clear graphical representations including error bars representing standard deviation or standard error as appropriate .

Q: How should researchers reconcile conflicting data regarding mnhC1's role in antibiotic resistance mechanisms?

A: When reconciling conflicting data about mnhC1's role in antibiotic resistance, implement a systematic meta-analytical approach. First, create a comprehensive table documenting all experimental parameters from conflicting studies, including bacterial strains, growth conditions, antibiotic concentrations, and experimental endpoints. Identify potential sources of variation such as differences in genetic background, measurement techniques, or environmental factors. Design validation experiments that specifically address these variables, incorporating appropriate controls and sufficient replication (n≥6 biological replicates) to achieve adequate statistical power. Perform dose-response experiments across a wide concentration range rather than single-point measurements. For mechanistic understanding, combine genetic approaches (gene deletion, complementation, site-directed mutagenesis) with direct measurement of antibiotic accumulation and membrane potential. Consider potential indirect effects by measuring expression of other resistance determinants in mnhC1 mutants. Apply statistical methods such as two-way ANOVA to assess interaction effects between mnhC1 status and experimental conditions. Present findings as forest plots to visualize effect sizes across different experimental paradigms. This comprehensive approach will help distinguish direct contributions of mnhC1 to resistance from context-dependent or indirect effects .

Integration with Systems Biology Approaches

Q: How can researchers integrate mnhC1 functional data with broader systems biology studies of Staphylococcus aureus?

A: Integrating mnhC1 functional data with systems biology approaches requires a multi-omics strategy. Begin by performing RNA-Seq analysis comparing wild-type and mnhC1 mutant strains under various stress conditions to identify compensatory transcriptional responses and co-regulated genes. Complement this with proteomics profiling using techniques such as SILAC or TMT labeling to quantify protein-level changes. Construct protein-protein interaction networks through affinity purification-mass spectrometry (AP-MS) with tagged mnhC1 to identify physical interactors. Apply metabolomics to quantify changes in ion concentrations, pH, and energy metabolism parameters. Integrate these datasets using computational approaches such as weighted gene correlation network analysis (WGCNA) or Bayesian network inference to identify functional modules connected to mnhC1 activity. For phenotypic integration, conduct genome-wide synthetic genetic array analyses to identify genes with epistatic relationships to mnhC1. Develop mathematical models simulating ion homeostasis incorporating experimentally determined kinetic parameters from recombinant protein studies. Validate model predictions through targeted experimental interventions. This integrated approach will position mnhC1 function within the broader context of S. aureus physiology and pathogenesis, potentially revealing unexpected roles and regulatory connections .

Q: What methodological approaches can link mnhC1 function to Staphylococcus aureus virulence in experimental infection models?

A: To establish the relationship between mnhC1 function and S. aureus virulence, researchers should implement a comprehensive host-pathogen interaction framework. Begin with comparative virulence studies using isogenic wild-type, mnhC1 deletion, and complemented strains in multiple infection models (invertebrate, murine systemic, skin/soft tissue, and biofilm infections). Quantify bacterial burden, dissemination, and host survival rates. Apply tissue-specific transcriptomics to bacteria recovered from different infection sites to measure mnhC1 expression in vivo. For mechanistic insights, engineer strains with mnhC1 mutations affecting specific functional properties (ion selectivity, transport rates) and assess their virulence phenotypes. Measure the impact of mnhC1 function on key virulence determinants including toxin production, immune evasion factors, and biofilm formation using quantitative assays. To understand host response effects, perform dual RNA-Seq on infected tissues to simultaneously capture host and pathogen transcriptional changes. Use intravital microscopy with fluorescently labeled bacteria to visualize infection dynamics in real-time. Employ neutrophil killing assays to assess whether mnhC1 contributes to phagocyte resistance. These approaches collectively will establish whether and how mnhC1-mediated ion homeostasis contributes to S. aureus pathogenesis in different host environments .

Comparative Analysis with Other Bacterial Species

Q: How should researchers design experiments to compare the function of S. aureus mnhC1 with homologous proteins from other pathogenic bacteria?

A: Designing comparative experiments for S. aureus mnhC1 and homologs from other bacterial species requires a structured approach addressing both sequence-function relationships and physiological contexts. Begin with comprehensive bioinformatic analysis using tools like HMMER and BLAST to identify true homologs, followed by multiple sequence alignment and phylogenetic reconstruction to establish evolutionary relationships. Create a standardized expression system where all homologs are cloned with identical tags in the same vector backbone, enabling fair comparison of expression levels and purification yields. Purify each protein using identical protocols and reconstitute into liposomes of defined composition for functional studies. Implement parallel measurement of transport kinetics, ion selectivity, and pH dependence using fluorescence-based assays under identical conditions. For in vivo comparison, perform complementation studies where each homolog is expressed in a mnhC1-deficient S. aureus strain, followed by comprehensive phenotypic characterization including growth curves under various stress conditions, antibiotic susceptibility testing, and virulence factor production. Apply statistical approaches such as principal component analysis to identify patterns in functional parameters across homologs. This systematic comparison will reveal conserved and divergent functional properties that can be correlated with bacterial lifestyle and pathogenic potential.

Methodological Approaches for Drug Discovery

Q: What experimental screening approaches can identify potential inhibitors targeting the recombinant mnhC1 protein?

A: Developing a robust inhibitor screening pipeline for mnhC1 requires a multi-stage approach. Begin with in silico screening by constructing a high-quality homology model of mnhC1 based on structurally characterized antiporter homologs, followed by virtual screening of compound libraries targeting predicted ion binding sites or conformational transition points. Progress to biochemical screening using purified recombinant mnhC1 reconstituted in proteoliposomes or nanodiscs with fluorescent ion indicators to measure transport inhibition in a high-throughput format. Develop a quantitative assay protocol with Z' factor >0.5 to ensure statistical reliability. Counter-screen hits against mammalian Na⁺/H⁺ exchangers to identify selective inhibitors. For hit validation, determine IC50 values and mechanism of inhibition (competitive, non-competitive) through detailed kinetic analysis. Assess membrane integrity during compound exposure to eliminate false positives that act as ionophores. Progress to cellular assays using wild-type and mnhC1-overexpressing S. aureus strains to confirm target engagement in biological context. For advanced candidates, perform structural studies (X-ray, cryo-EM) of mnhC1-inhibitor complexes to guide structure-based optimization. This systematic approach will yield well-characterized lead compounds with defined mechanisms of action against this potential antimicrobial target .

Q: How can researchers evaluate whether inhibition of mnhC1 function potentiates existing antibiotic treatments against Staphylococcus aureus?

A: To evaluate mnhC1 inhibition as an antibiotic potentiator, implement a systematic combination therapy assessment framework. Begin with checkerboard assays across a matrix of mnhC1 inhibitor concentrations and various antibiotics to calculate fractional inhibitory concentration indices (FICI), identifying synergistic (FICI ≤0.5), additive (FICI >0.5-1.0), or antagonistic (FICI >4.0) interactions. Verify findings with time-kill kinetics measuring bacterial survival over 24 hours during combination treatment. To establish specificity, perform identical experiments with mnhC1-deleted strains, where true on-target potentiation should show no synergy. Assess impact on resistance development through serial passage experiments comparing mutation frequency and resistance stability in single versus combination therapy. Mechanistically, measure antibiotic accumulation using fluorescent derivatives or LC-MS/MS quantification to determine if mnhC1 inhibition enhances drug uptake. Examine effects on membrane potential and pH homeostasis using appropriate fluorescent probes. For translation potential, evaluate combination efficacy in biofilm models and infected primary human cells. Test promising combinations in murine infection models, measuring bacterial burden, inflammatory markers, and tissue damage. This comprehensive approach will determine whether mnhC1 represents a viable target for antibiotic adjuvant therapy against resistant S. aureus infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.