Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit E1

Shipped with Ice Packs
In Stock

Description

Functional Roles in S. aureus Physiology

Primary functions:

  • Na⁺/H⁺ antiport: Mediates electroneutral exchange of sodium and protons, critical for pH homeostasis and Na⁺ extrusion under alkaline stress .

  • Proton motive force (PMF) maintenance: Works with the Sno complex (SnoA-G) to sustain membrane potential via NADH oxidation, particularly under microaerophilic conditions .

  • Antimicrobial resistance: Mutants lacking snoD (a homolog of mnhE1) exhibit reduced susceptibility to thrombin-induced platelet microbicidal proteins (tPMP-1) .

Key experimental findings:

Strain PhenotypeNaCl TolerancetPMP-1 Survival (%)MIC of Protamine (mg/ml)
Parental (ISP479C/SH1000)Sensitive20–27%1
snoD Mutant (ISP479R)Resistant75–84%8
Complemented MutantRestored35–47%1

Data adapted from transposon disruption studies .

Recombinant Production and Biotechnological Applications

Expression systems:

  • Produced in E. coli using Tris-based buffers with N-terminal 10xHis tags for purification .

Homology:

  • Shares structural similarities with respiratory chain components (e.g., Bacillus subtilis MrpD) .

  • Distinct from secondary antiporters (e.g., E. coli NhaA): Requires seven subunits for activity and couples ion transport to redox reactions .

Respiration linkage:

  • Na⁺ extrusion is CCCP-sensitive, indicating PMF dependency .

  • Inhibitors like piericidin A (complex I blocker) mimic snoD mutant phenotypes, suggesting electron transport coupling .

Research Implications and Future Directions

  • Antimicrobial targeting: The Sno complex’s role in PMF and drug resistance highlights its potential as a therapeutic target .

  • Unresolved questions:

    • Precise stoichiometry of the seven-subunit complex.

    • Mechanistic details of NADH coupling in Na⁺/H⁺ exchange .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhE1; SA0809; Na(+/H(+ antiporter subunit E1; Mnh complex subunit E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
mnhE1
Target Protein Sequence
MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
Uniprot No.

Target Background

Function
The Mnh complex is a Na(+)/H(+) antiporter involved in Na(+) excretion.
Database Links

KEGG: sau:SA0809

Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the S. aureus Na(+)/H(+) antiporter complex?

The S. aureus Na(+)/H(+) antiporter is a novel type of multisubunit transport system composed of seven different subunits encoded by a single operon. These seven open reading frames (ORFs) are genetically organized without intermediate terminator or promoter sequences, indicating they function as a coordinated unit. Hydropathy analysis reveals all seven subunits are highly hydrophobic proteins, consistent with their membrane-embedded localization. The functional complex facilitates the exchange of sodium or lithium ions for protons across the cytoplasmic membrane, playing crucial roles in maintaining ion homeostasis and pH regulation in the bacterial cell .

How was the S. aureus Na(+)/H(+) antiporter initially characterized?

The initial characterization employed a complementation approach using an Escherichia coli mutant lacking major Na(+)/H(+) antiporters. Researchers cloned a 7-kbp region from S. aureus chromosomal DNA and identified seven ORFs necessary for antiporter function. The functional validation involved demonstrating that E. coli cells harboring plasmids containing these genes could grow in media with high salt concentrations (0.2 M NaCl or 10 mM LiCl) while control cells without the plasmids could not survive under these conditions. Membrane vesicles prepared from transformed cells exhibited Na(+)/H(+) antiport activity, confirming the molecular function of the cloned genes .

What physiological functions does the Na(+)/H(+) antiporter serve in S. aureus?

The antiporter performs several critical functions in S. aureus physiology. First, it establishes an electrochemical potential of Na+ across the cytoplasmic membrane, which drives Na+-coupled processes such as solute transport and potentially flagellar rotation. Second, it extrudes toxic Na+ and Li+ ions, enabling bacterial survival in high-salt environments. Third, it contributes to pH homeostasis, allowing growth under alkaline conditions. Experimental evidence demonstrates that E. coli cells expressing the S. aureus antiporter genes gained the ability to grow under alkaline conditions that normally inhibit growth of antiporter-deficient mutants .

What experimental approaches are most effective for studying the structure-function relationships of antiporter subunits?

An effective experimental workflow combines multiple complementary approaches:

  • Recombinant expression and purification: Express individual subunits (like E1) in suitable bacterial, yeast, baculovirus, or mammalian expression systems, with optimization of conditions to maintain protein stability and proper folding. E. coli expression systems have proven particularly useful for initial characterization studies .

  • Reconstitution studies: Incorporate purified subunits into proteoliposomes to assess transport activity of individual components or combinations.

  • Site-directed mutagenesis: Identify critical residues involved in ion binding, transport, or subunit interactions.

  • Structural analysis: Apply techniques such as cryo-electron microscopy or X-ray crystallography to resolve atomic-level structures.

  • Functional assays: Measure ion transport using techniques like fluorescent ion indicators, radioisotope flux studies, or patch-clamp electrophysiology.

This multi-faceted approach allows researchers to correlate structural features with functional properties of each antiporter subunit .

How does recombination affect the evolution of Na(+)/H(+) antiporter genes in clinical S. aureus isolates?

Large-scale recombination events significantly impact the evolution of S. aureus, including genes encoding membrane transport systems. Research has identified hybrid clones (such as ST71) that evolved through multiple large-scale recombination events affecting substantial portions of the chromosome (up to 329 kb) spanning the origin of replication. These recombination events can result in allele replacement and gain or loss of genes influencing host-pathogen interactions. Such genomic remodeling can potentially affect antiporter function by introducing novel sequence variants or regulatory elements. Molecular functional analyses of hybrid clones have demonstrated acquisition of multiple novel pathogenic traits related to immune evasion and host adaptation, suggesting antiporter variations might similarly contribute to enhanced fitness in specific ecological niches .

What expression systems are optimal for producing functional recombinant Na(+)/H(+) antiporter subunits?

The optimal expression system depends on experimental objectives and downstream applications:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, simple handling, cost-effective, established protocolsLimited post-translational modifications, inclusion body formation common with membrane proteinsInitial characterization, mutagenesis studies, antibody production
YeastEukaryotic post-translational modifications, good for membrane proteinsLower yields than E. coli, longer production timeStructural studies requiring properly folded protein
BaculovirusHigh expression of complex proteins, near-native foldingTechnical complexity, higher cost, longer production timelineFunctional studies requiring authentic protein conformation
Mammalian cellsMost authentic post-translational modificationsLowest yields, highest cost, most complex handlingStudies where native-like activity is essential

For antiporter subunits like E1, E. coli systems have been successfully employed for initial characterization, while more complex expression hosts may be required for detailed structural studies. Purification typically involves immobilized metal affinity chromatography with histidine tags, followed by size exclusion or ion exchange chromatography .

What are the critical parameters for measuring Na(+)/H(+) antiporter activity in experimental settings?

Accurate measurement of antiporter activity requires careful control of several experimental parameters:

  • Membrane vesicle preparation: Inside-out vesicles allow direct access to the cytoplasmic face of the antiporter. Quality control should verify membrane integrity and orientation.

  • Ion gradients: Precisely defined Na+ and H+ gradients must be established and maintained during experiments.

  • Energy source: Since the antiporter couples ion transport to energy, experiments should control energization state (e.g., through respiratory substrates or artificial gradients).

  • Inhibitor controls: H+ conductors can distinguish between Na+/H+ antiport and direct Na+ pumping.

  • Detection methods: Fluorescent pH indicators, Na+-sensitive dyes, or radioisotope flux measurements can be employed with appropriate calibration.

When measuring Na+ extrusion activity, researchers have observed that respiration-driven activity is sensitive to H+ conductors, confirming the system functions as an Na+/H+ antiporter rather than a respiratory Na+ pump .

How can researchers overcome solubility and stability issues with recombinant antiporter subunits?

Membrane proteins like antiporter subunits present significant challenges for recombinant expression and purification. Effective strategies include:

  • Optimization of detergents: Screen multiple detergent types and concentrations to identify conditions that maintain protein stability while extracting from membranes. Mild detergents like n-dodecyl-β-D-maltoside (DDM) often work well with membrane transporters.

  • Fusion partners: N-terminal fusion tags such as MBP (maltose-binding protein) or SUMO can improve solubility.

  • Expression temperature: Lower temperatures (16-20°C) typically improve folding of membrane proteins.

  • Codon optimization: Adjust codon usage to match the expression host for improved translation efficiency.

  • Stabilizing additives: Include glycerol (typically 10%) in all buffers to enhance stability during storage. Current protocols recommend storage at -20°C for short-term and -80°C for extended storage .

  • Truncation constructs: Engineer smaller stable domains if the full protein proves problematic.

Each antiporter subunit may require individualized optimization strategies based on its specific physico-chemical properties and expression behavior.

What approaches help distinguish between direct and indirect effects when studying antiporter function in cellular systems?

Differentiating direct antiporter activity from secondary cellular responses requires careful experimental design:

  • Reconstituted systems: Purify the antiporter complex or individual subunits and reconstitute into proteoliposomes for direct functional assessment isolated from other cellular components.

  • Specific inhibitors: Develop or apply compounds that selectively block antiporter function without affecting other cellular processes.

  • Rapid kinetic measurements: Monitor ion fluxes on millisecond timescales to capture immediate transport events before secondary responses occur.

  • Genetic controls: Compare antiporter-deficient mutants with complemented strains expressing wild-type or mutant variants.

  • Membrane potential monitoring: Simultaneously track membrane potential to account for electrogenic effects of ion transport.

These approaches collectively enable researchers to isolate specific antiporter functions from downstream cellular adaptations or compensatory mechanisms .

How does the S. aureus Na(+)/H(+) antiporter compare structurally and functionally to similar systems in other bacteria?

The multisubunit organization of the S. aureus Na(+)/H(+) antiporter represents a novel transport system architecture compared to many other bacterial antiporters. While many bacteria possess antiporters composed of single proteins or smaller complexes, the seven-subunit structure in S. aureus suggests unique functional properties or regulatory mechanisms. Of particular interest is the sequence similarity observed between some antiporter subunits and components of the respiratory chain, indicating potential evolutionary relationships between these membrane transport systems. Comparative analysis suggests the S. aureus antiporter may integrate both ion transport and energetic functions in ways distinct from simpler bacterial transporters. These structural differences may reflect adaptation to specific environmental challenges faced by S. aureus, such as colonization of high-salt niches or survival during host immune responses .

What is the potential role of Na(+)/H(+) antiporter function in S. aureus pathogenesis and antibiotic resistance?

The Na(+)/H(+) antiporter likely contributes to S. aureus pathogenesis through multiple mechanisms:

  • Survival in host environments: By regulating intracellular pH and ion concentrations, the antiporter enables bacterial persistence in diverse host niches with varying salt concentrations and pH levels.

  • Stress response: The antiporter may participate in bacterial responses to host-derived antimicrobial factors that disrupt membrane potential.

  • Metabolic adaptation: Ion homeostasis directly impacts bacterial metabolism, potentially affecting virulence factor production.

  • Antibiotic tolerance: Changes in membrane potential and pH gradients can influence susceptibility to antibiotics, particularly those requiring proton motive force for uptake.

Research on hybrid S. aureus clones demonstrates that recombination events can remodel host-pathogen interactions, suggesting that variants in antiporter genes might similarly contribute to enhanced virulence or antibiotic resistance. The multisubunit nature of the antiporter also presents potential opportunities for developing novel antimicrobial strategies targeting this complex .

How can cryo-electron microscopy advance our understanding of the complete Na(+)/H(+) antiporter complex structure?

Cryo-electron microscopy (cryo-EM) offers unprecedented opportunities for elucidating the structure of challenging membrane protein complexes like the multisubunit Na(+)/H(+) antiporter. This technique allows visualization of the intact complex in a near-native lipid environment without requiring crystallization. For the S. aureus Na(+)/H(+) antiporter, cryo-EM could reveal:

  • Subunit arrangement: The spatial organization of all seven subunits, including the E1 subunit, within the functional complex.

  • Ion conduction pathway: The specific channel or pore through which ions are transported.

  • Binding sites: The precise locations where Na+ and H+ interact with the protein.

  • Conformational states: Different structural states corresponding to stages in the transport cycle.

Key methodological considerations include purification of sufficient quantities of stable, homogeneous protein complex, optimization of detergent or nanodisc reconstitution, and potentially trapping the complex in defined functional states using inhibitors or non-hydrolyzable substrate analogs .

What genomic approaches can identify variations in antiporter genes across S. aureus clinical isolates?

Comprehensive genomic analysis of antiporter gene variations should incorporate:

  • Whole-genome sequencing: Using next-generation sequencing to identify SNPs, insertions, deletions, and recombination events affecting antiporter genes across diverse clinical isolates.

  • Phylogenetic analysis: Constructing evolutionary trees based on antiporter gene sequences to track divergence across S. aureus lineages.

  • Recombination detection: Employing specialized algorithms to identify horizontal gene transfer events affecting antiporter genes, similar to those documented for other S. aureus virulence factors.

  • Structure-function correlation: Mapping sequence variations to structural models to predict functional impacts.

  • Transcriptomic analysis: Examining expression patterns of antiporter genes under different environmental conditions.

Recent studies demonstrate that large-scale recombination events (spanning over 300kb) have generated hybrid S. aureus clones with altered host-pathogen interaction profiles. Similar genomic remodeling could affect antiporter genes, potentially creating variants with enhanced function in specific ecological niches or host environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.