Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit G1 (mnhG1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Staphylococcus aureus Na (+)/H (+) Antiporter Subunit G1 (mnhG1)

Recombinant Staphylococcus aureus Na (+)/H (+) antiporter subunit G1 (mnhG1) is a protein component derived from the bacterium Staphylococcus aureus. This bacterium is a Gram-positive, round-shaped microorganism commonly found on human skin and in the upper respiratory tract. It can act as both a commensal and an opportunistic pathogen, causing a range of infections from minor skin conditions to life-threatening diseases .

The Na (+)/H (+) antiporter plays a crucial role in maintaining cellular homeostasis by regulating the balance of sodium and hydrogen ions across cell membranes. This function is essential for bacterial survival, especially under conditions of high salt concentrations or alkaline pH .

Function and Importance of Na (+)/H (+) Antiporters

Na (+)/H (+) antiporters are membrane proteins that facilitate the exchange of sodium ions for hydrogen ions across cell membranes. This process helps maintain the intracellular pH and sodium concentration, which are vital for cellular metabolism and survival. In Staphylococcus aureus, these antiporters enable the bacterium to thrive in environments with high salt concentrations, such as human skin and mucous membranes .

Table 1: Characteristics of Na (+)/H (+) Antiporters in Staphylococcus aureus

CharacteristicDescription
FunctionExchanges sodium ions for hydrogen ions across cell membranes to maintain cellular homeostasis.
ImportanceEssential for bacterial survival in high salt environments and alkaline conditions.
ExpressionCan be expressed in various host systems like E. coli for research purposes.

Recombinant Expression of mnhG1

Recombinant expression of the mnhG1 subunit involves cloning the gene encoding this protein into a suitable host organism, such as E. coli, yeast, or mammalian cells. This allows for large-scale production of the protein for research and potential therapeutic applications .

Table 2: Recombinant Expression Systems for mnhG1

Host SystemAdvantagesApplications
E. coliHigh yield, cost-effectiveResearch, vaccine development
YeastEukaryotic post-translational modificationsBiotechnology applications
Mammalian CellsNative-like protein structure and functionTherapeutic protein production

Research Findings and Applications

Research on recombinant Na (+)/H (+) antiporter subunits like mnhG1 focuses on understanding their role in bacterial physiology and pathogenesis. These studies can lead to the development of novel therapeutic strategies targeting bacterial ion homeostasis mechanisms .

Table 3: Potential Applications of mnhG1 Research

ApplicationDescription
Vaccine DevelopmentUtilizing recombinant proteins for vaccine design against Staphylococcus aureus infections.
Therapeutic TargetsIdentifying antiporter inhibitors as potential antibacterial agents.
Basic ResearchElucidating mechanisms of bacterial ion homeostasis and survival.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mnhG1; SAOUHSC_00883; Na(+/H(+ antiporter subunit G1; Mnh complex subunit G1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Staphylococcus aureus (strain NCTC 8325)
Target Names
mnhG1
Target Protein Sequence
MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
Uniprot No.

Target Background

Function
Mnh complex is a sodium/proton antiporter involved in sodium excretion.
Database Links
Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the Na+/H+ antiporter in S. aureus?

The Na+/H+ antiporter in S. aureus is a multisubunit complex comprising seven open reading frames (ORFs) that function together as a cohesive unit. Based on research findings, these ORFs are organized in an operon structure with a promoter-like sequence upstream of the first ORF and a terminator-like sequence downstream of the seventh ORF . No terminator-like or promoter-like sequences were identified between the ORFs, supporting their organization as a single transcriptional unit.
Functionally, this antiporter system mediates the exchange of sodium or lithium ions for protons across the bacterial membrane. Experimental evidence demonstrates that when expressed in E. coli mutants lacking major Na+/H+ antiporters, the S. aureus system enables growth in media containing 0.2 M NaCl or 10 mM LiCl, environments that would otherwise be lethal to these mutant strains . This indicates the antiporter's critical role in managing ion homeostasis under high-salt conditions.

How does the Na+/H+ antiporter system contribute to S. aureus pathogenicity?

The Na+/H+ antiporter system likely contributes to S. aureus pathogenicity through multiple mechanisms:

  • Enabling survival in high-salt environments encountered during host colonization and infection

  • Maintaining intracellular pH homeostasis during phagocytosis, potentially contributing to intracellular persistence

  • Supporting bacterial adaptation to varying environmental conditions across different infection sites

  • Potentially contributing to biofilm formation and antibiotic tolerance
    S. aureus infections range from localized skin lesions to severe systemic infections with high mortality rates, particularly for methicillin-resistant strains. The ability to maintain ion homeostasis across these diverse infection environments may be a critical virulence determinant, though direct experimental evidence linking the Na+/H+ antiporter to virulence requires further investigation.

What expression systems are most effective for producing recombinant S. aureus membrane proteins?

For heterologous expression of S. aureus membrane proteins like mnhG1, several systems have proven effective:

  • E. coli expression systems using strains specifically engineered for membrane protein production (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Codon optimization for the expression host to improve translation efficiency

  • Fusion tags that enhance solubility and facilitate purification (e.g., maltose-binding protein, thioredoxin)

  • Inducible promoter systems allowing tight regulation of expression levels

  • Co-expression with chaperones to improve folding and prevent aggregation
    E. coli has been successfully used for functional expression of the complete S. aureus Na+/H+ antiporter system, as demonstrated in complementation assays using Na+/H+ antiporter-deficient mutants . For complex multisubunit proteins, co-expression strategies may be necessary to ensure proper assembly of the functional complex.

What methodological approaches are recommended for studying Na+/H+ antiporter function?

Multiple complementary approaches can be employed to characterize Na+/H+ antiporter function:

  • Genetic complementation: Testing the ability of mnhG1 and other subunits to restore salt tolerance in antiporter-deficient bacterial strains

  • Membrane vesicle assays: Preparing inverted membrane vesicles from expressing cells to directly measure Na+/H+ exchange activity using pH-sensitive or Na+-sensitive fluorescent probes

  • Electrophysiological techniques: Patch-clamp or solid-supported membrane electrophysiology to measure ion currents

  • Site-directed mutagenesis: Systematic mutation of conserved residues to identify amino acids critical for transport activity

  • Isotope flux measurements: Using radioisotopes (22Na+) to quantify transport kinetics
    When applying these methods, it's essential to include appropriate controls, such as comparing wild-type and inactive mutant versions of the protein, and validating that the expressed protein is correctly localized to the membrane fraction.

How can researchers address the challenges of membrane protein purification for structural studies of mnhG1?

Purification of membrane proteins like mnhG1 presents unique challenges that can be addressed through the following approaches:

  • Detergent screening: Systematically testing different detergent types and concentrations for optimal solubilization while maintaining protein stability and function

  • Native-like environments: Utilizing nanodiscs, styrene-maleic acid lipid particles (SMALPs), or amphipols to maintain the protein in a lipid environment

  • Thermostability assays: Implementing fluorescence-based thermostability assays to identify conditions that stabilize the purified protein

  • Co-expression strategies: For multisubunit complexes, co-expressing multiple subunits to promote proper assembly and stability

  • Fusion protein approaches: Adding solubility-enhancing fusion partners that can be cleaved after purification
    The methodological choices should be guided by the intended downstream applications, with structural biology techniques like cryo-electron microscopy requiring different optimization than functional assays.

What is the potential of Na+/H+ antiporters as therapeutic targets for S. aureus infections?

The Na+/H+ antiporter represents a promising therapeutic target for S. aureus infections for several reasons:

  • Essential function in bacterial survival under physiologically relevant conditions

  • Structural differences from human transporters that could enable selective targeting

  • The multisubunit nature providing multiple potential drug binding sites

  • Potential role in supporting bacterial survival during antibiotic treatment
    With mortality rates from MRSA bacteremia reaching nearly 50% compared to 22.2% for methicillin-susceptible strains, novel therapeutic approaches are urgently needed . The development of selective inhibitors targeting the Na+/H+ antiporter system could complement existing antibiotic therapies and potentially reduce the emergence of resistance.

How might research on mnhG1 integrate with current S. aureus vaccine development strategies?

While Na+/H+ antiporter components have not been primary targets in current vaccine development efforts, several approaches could incorporate these proteins into vaccine strategies:

  • Multicomponent vaccines: If mnhG1 contains surface-exposed domains, it could be included in multicomponent vaccines alongside established targets like capsular polysaccharides and surface proteins

  • Bioconjugation approaches: Recent advances in conjugating S. aureus capsular polysaccharides to native S. aureus proteins have shown promise and could potentially incorporate antiporter components

  • Adjuvant selection: The failures of previous S. aureus vaccines highlight the importance of selecting adjuvants that promote both humoral and Th1/Th17 cellular immune responses
    Previous S. aureus vaccine candidates that induced primarily antibody responses have failed in clinical trials, suggesting that successful approaches must elicit balanced immune responses including functional T cell activation .

What structural biology techniques are most appropriate for studying the multisubunit Na+/H+ antiporter complex?

The structural characterization of multisubunit membrane protein complexes like the Na+/H+ antiporter requires specialized approaches:

  • Cryo-electron microscopy (cryo-EM): Particularly suitable for large membrane protein complexes, enabling visualization of the intact complex in different functional states

  • Cross-linking mass spectrometry: Providing insights into subunit organization and interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifying dynamic regions and potential substrate binding sites

  • Single-particle analysis: Capturing conformational heterogeneity that may reflect different functional states

  • Molecular dynamics simulations: Predicting ion permeation pathways and conformational changes associated with transport
    Integrating structural data with functional assays is essential for establishing structure-function relationships and identifying potential sites for therapeutic intervention.

How can researchers distinguish the specific role of mnhG1 within the multisubunit antiporter complex?

Distinguishing the specific contribution of mnhG1 within the multisubunit complex requires a systematic approach:

What experimental controls are essential when studying recombinant Na+/H+ antiporter function?

Robust experimental design for studying Na+/H+ antiporter function should include the following controls:

  • Negative controls: Non-expressing cells or membranes to establish baseline activity

  • Positive controls: Well-characterized Na+/H+ antiporters from other organisms

  • Ion specificity controls: Testing transport of different ions (Na+, Li+, K+) to confirm specificity

  • Inhibitor controls: Using known transport inhibitors to validate the assay system

  • Protein expression verification: Western blotting or other methods to confirm successful expression and membrane localization

  • Functional complementation: Confirming that the expressed protein rescues the relevant phenotype in mutant strains
    These controls help distinguish genuine antiporter activity from artifacts and provide benchmarks for comparing mutant or modified versions of the protein.

How should researchers address apparent contradictions in Na+/H+ antiporter data between different experimental systems?

When faced with contradictory results between experimental systems, researchers should consider:

  • Differences in expression levels: Quantifying protein expression to normalize activity measurements

  • Membrane composition effects: Different lipid environments can significantly impact transporter function

  • Post-translational modifications: Investigating whether modifications present in native but not recombinant systems affect function

  • Assay sensitivity limitations: Different techniques have varying sensitivity and may detect different aspects of transport activity

  • Experimental conditions: Systematic variation of pH, ion concentrations, and temperature to identify condition-dependent effects
    A multifaceted approach using complementary techniques can help resolve apparent contradictions and build a more complete understanding of antiporter function.

What emerging technologies might advance understanding of Na+/H+ antiporter structure and function?

Several emerging technologies hold promise for advancing Na+/H+ antiporter research:

  • Cryo-electron tomography: Visualizing transporters in their native membrane environment

  • Single-molecule FRET: Monitoring conformational changes during transport cycles

  • Mass photometry: Characterizing subunit stoichiometry and complex assembly

  • Nanobody-based tools: Developing conformation-specific probes to capture different functional states

  • AlphaFold2 and related AI approaches: Predicting structures of individual subunits and guiding experimental design
    Integrating these advanced technologies with established methods will provide unprecedented insights into the molecular mechanisms of Na+/H+ antiporter function.

How might systems biology approaches enhance understanding of the physiological roles of Na+/H+ antiporters in S. aureus?

Systems biology approaches can contextualize antiporter function within broader bacterial physiology:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.