Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

Shipped with Ice Packs
In Stock

Description

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine Synthesis Protein IcaD (icaD): Overview

The recombinant IcaD protein is a bioengineered version of the icaD gene product from Staphylococcus aureus, expressed in Escherichia coli. This protein is critical for synthesizing polysaccharide intercellular adhesin (PIA), a β-1,6-linked N-acetylglucosamine polymer essential for biofilm formation and virulence in staphylococcal pathogens .

Mechanistic Insights

  • Enzymatic Synergy: Coexpression of icaA and icaD significantly increases PIA production compared to icaA alone .

  • Regulatory Control: The icaADBC operon is regulated by IcaR (a TetR-family repressor) and environmental factors like glucose, ethanol, and osmolarity .

Protein Structure

  • Transmembrane Domains: IcaD’s two transmembrane domains suggest a role in stabilizing the IcaA-IcaD complex at the bacterial membrane .

  • His-Tag Modification: Recombinant IcaD includes an N-terminal His tag for purification and immobilization in biochemical assays .

Functional Interactions

ComponentRoleInteraction with IcaD
IcaACatalyzes PIA oligomer synthesisSynergizes with IcaD for enhanced activity
IcaCExports PIA and elongates chainsForms a tripartite complex with IcaA/IcaD
IcaBDeacetylates PIA for charge modificationIndirectly influenced by IcaD’s enzymatic role

Biofilm Formation and Pathogenicity

  • Virulence Factor: PIA-mediated biofilms enable S. aureus to evade host immune responses and resist antibiotics .

  • Prevalence in Isolates: ~77.3% of clinical S. aureus isolates harbor icaD, correlating with multidrug resistance (MDR) and biofilm production .

Key Findings from Clinical Studies

ParameterResultsSource
icaD Prevalence77.3% in S. aureus isolates (95.45% biofilm-positive)
MRSA Association22/29 MRSA isolates were icaD-positive
Phase VariantsicaD-negative variants emerge via IS256 insertion or ica locus loss

Transcriptional Control

  • IcaR Repression: IcaR binds to the icaADBC promoter, suppressing transcription. Mutations in IcaR (e.g., deletions) lead to hyperproduction of PIA .

  • SarA Regulation: In S. aureus, the global regulator SarA upregulates icaADBC while also inducing icaR, balancing PIA synthesis .

Environmental Triggers

FactorEffect on PIA/IcaDMechanism
High GlucoseInduces PIA synthesis via alleviation of IcaR repression
Ethanol/OsmolarityEnhances icaADBC transcription through IcaR destabilization
AminoglycosidesDisrupt IcaR-DNA binding, promoting PIA production

Diagnostic and Therapeutic Targets

  • Biomarker Potential: icaD detection via PCR or immunological assays could identify biofilm-forming S. aureus isolates .

  • Antibiofilm Strategies: Targeting IcaD-IcaA interactions or PIA synthesis may disrupt biofilm integrity .

Limitations in Recombinant IcaD Studies

  • Heterologous Expression: E. coli-expressed IcaD may lack post-translational modifications present in native S. aureus .

  • Phase Variability: Clinical isolates with icaD deletions or IS256 insertions complicate therapeutic targeting .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotation is recommended for multiple use to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While the tag type is determined during production, we are happy to prioritize development of a specified tag if you have a particular requirement. Please let us know your preference.
Synonyms
icaD; SACOL2690; Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD; PGA synthesis protein IcaD; Poly-beta-1,6-GlcNAc synthesis protein IcaD; Biofilm polysaccharide intercellular adhesin synthesis protein IcaD; Biofilm PIA synthesis protein IcaD; Intercellular adhesion protein D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Staphylococcus aureus (strain COL)
Target Names
icaD
Target Protein Sequence
MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES
Uniprot No.

Target Background

Function
IcaD is crucial for the synthesis of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. It plays a key role in enabling full IcaA N-acetylglucosaminyltransferase activity.
Database Links
Protein Families
IcaD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What role does icaD play in biofilm formation?

    The icaD protein is a critical component of the intercellular adhesion (ica) operon, which is responsible for synthesizing Poly-beta-1,6-N-acetyl-D-glucosamine (PNAG). This polysaccharide forms a major structural component of Staphylococcus aureus biofilms. Methodologically, biofilm formation capacity can be assessed through crystal violet staining assays, confocal laser scanning microscopy, and flow cell systems. Comparative studies between wild-type strains and icaD mutants typically demonstrate significant reductions in biofilm formation in the absence of functional icaD. The protein likely functions as a membrane anchor and molecular chaperone for IcaA, enhancing the enzymatic activity of the N-acetylglucosaminyltransferase complex required for PNAG synthesis .

  • How is recombinant icaD protein expressed and purified?

    According to available data, recombinant full-length Staphylococcus aureus icaD protein can be successfully expressed in E. coli expression systems with an N-terminal His tag. The methodological approach involves:

    Expression ParameterRecommended Condition
    Expression SystemE. coli
    TagN-terminal His tag
    Protein LengthFull Length (1-101)
    Final FormLyophilized powder
    Purity>90% by SDS-PAGE
    Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
    Reconstitution0.1-1.0 mg/mL in deionized sterile water
    Storage-20°C/-80°C with 5-50% glycerol aliquots

    For optimal expression, researchers should consider codon optimization for E. coli, lower induction temperatures (16-25°C), and careful optimization of detergent conditions during membrane protein extraction and purification steps .

  • What experimental methods can verify icaD functionality?

    To verify the functionality of recombinant icaD protein, researchers should implement a multi-tiered experimental approach:

    • Complementation assays: Introducing the recombinant icaD gene into icaD-deficient S. aureus strains to assess restoration of biofilm formation.

    • In vitro PNAG synthesis: Reconstituting the N-acetylglucosaminyltransferase activity using purified icaD and icaA proteins.

    • Binding assays: Demonstrating direct interaction between icaD and other ica operon proteins using techniques such as surface plasmon resonance or pull-down assays.

    • Biofilm quantification: Comparing biofilm formation capacity using crystal violet staining, confocal microscopy with PNAG-specific stains, or flow cell systems.

    • Antibiofilm susceptibility testing: Evaluating how functional icaD affects biofilm resistance to antimicrobial agents and immune clearance.

    These methods collectively provide a comprehensive assessment of whether the recombinant icaD protein maintains its native biological activity .

  • How do storage conditions affect icaD protein stability?

    Based on established protocols, recombinant icaD protein stability is highly dependent on proper storage conditions. Methodologically, researchers should:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Perform aliquoting after reconstitution to avoid repeated freeze-thaw cycles

    • Add 5-50% glycerol (recommended final concentration: 50%) to stabilize the protein

    • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for optimal stability

    • Store working aliquots at 4°C for up to one week only

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    Stability studies should include periodic activity assessment through functional assays and structural integrity verification via circular dichroism or thermal shift assays to establish optimal storage protocols for specific experimental conditions .

Advanced Research Questions

  • What approaches can effectively analyze icaD interactions with other ica operon proteins?

    Investigating icaD interactions with other ica operon proteins requires sophisticated methodological approaches:

    • Co-immunoprecipitation with tagged proteins: Using His-tagged icaD (as described in search result ) to pull down interaction partners.

    • Bacterial two-hybrid systems modified for membrane proteins: Detecting direct protein-protein interactions in vivo.

    • FRET/BRET assays: Measuring proximity-based energy transfer between fluorescently labeled ica proteins.

    • Cross-linking mass spectrometry (XL-MS): Identifying amino acid residues involved in protein-protein interfaces.

    • Surface plasmon resonance: Quantifying binding kinetics and affinities between purified components.

    Interaction TechniqueAdvantageLimitation
    Co-immunoprecipitationWorks in native conditionsMay detect indirect interactions
    Bacterial two-hybridIn vivo detectionMay have false positives
    FRET/BRETReal-time in vivo monitoringRequires fluorescent tagging
    XL-MSIdentifies specific interaction sitesRequires specialized equipment
    Surface plasmon resonanceProvides binding kineticsRequires purified proteins

    Combining multiple complementary approaches provides the most comprehensive understanding of how icaD functions within the PNAG synthesis complex .

  • How can site-directed mutagenesis inform structure-function relationships of icaD?

    Site-directed mutagenesis represents a powerful approach to establish structure-function relationships for icaD. Methodologically, researchers should:

    1. Identify critical residues through sequence conservation analysis across staphylococcal species

    2. Target transmembrane domains and predicted interaction interfaces based on the 101-amino acid sequence

    3. Generate alanine scanning mutants or specific substitutions using PCR-based mutagenesis

    4. Express mutant proteins following the E. coli expression system protocol

    5. Assess mutant proteins for:

      • Proper membrane localization

      • Interaction with icaA and other ica proteins

      • PNAG synthesis capacity

      • Biofilm formation restoration in icaD-deficient strains

    This systematic approach can identify specific amino acids or domains essential for icaD function in PNAG synthesis and biofilm formation. The recombination detection methods described in search result can be applied to analyze the evolutionary conservation of these critical residues .

  • How does recombinant icaD incorporation affect biofilm matrix architecture?

    Investigating how recombinant icaD incorporation affects biofilm matrix architecture requires advanced microscopy and biophysical techniques:

    • Confocal laser scanning microscopy (CLSM): Visualizing the three-dimensional structure of biofilms formed with native versus recombinant icaD.

    • Scanning electron microscopy (SEM): Examining the surface topography and ultrastructure of biofilms.

    • Atomic force microscopy (AFM): Measuring nanomechanical properties of biofilms including stiffness and adhesion forces.

    • Rheological measurements: Characterizing viscoelastic properties of the biofilm matrix.

    • Fluorescence recovery after photobleaching (FRAP): Assessing molecular mobility within the matrix.

    Researchers should compare biofilms formed by wild-type strains with those formed by icaD-deficient strains complemented with recombinant icaD. Quantitative analysis of biofilm parameters including thickness, biomass, roughness coefficient, and porosity provides insights into how icaD-mediated PNAG production influences the physical properties of the biofilm matrix .

  • What approaches can detect potential conformational changes in icaD during PNAG synthesis?

    Monitoring conformational changes in icaD during PNAG synthesis requires specialized biophysical techniques adapted for membrane proteins:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping solvent-accessible regions and conformational dynamics during PNAG synthesis.

    • Single-molecule FRET: Detecting distance changes between labeled residues during protein function.

    • EPR spectroscopy with site-directed spin labeling: Measuring local dynamics and distances between labeled sites.

    • Time-resolved fluorescence spectroscopy: Monitoring changes in fluorescence lifetime of intrinsic or introduced fluorophores.

    • Cryo-electron microscopy: Capturing different conformational states during the catalytic cycle.

    Experimental design should include comparative analyses between active and inactive states, potentially modulated through substrate binding, interaction with partner proteins, or specific mutations. These approaches can establish the molecular mechanism by which icaD contributes to PNAG polymerization through coordinated action with other ica proteins .

  • How can functional repeatability be established in icaD research?

    Establishing functional repeatability in icaD research is crucial for developing standardized protocols and ensuring reproducible results. According to the principles outlined in search result regarding functional repeatability in design science:

    • Standardized expression and purification protocols: Different research teams should follow identical protocols for producing recombinant icaD protein, as outlined in search result .

    • Validated activity assays: Establish quantitative metrics for icaD functionality based on PNAG synthesis and biofilm formation.

    • Reference standards: Develop control strains and protein preparations that serve as benchmarks for comparison.

    • Round-robin testing: Multiple laboratories performing identical experiments to verify consistency of results.

    • Statistical validation: Apply rigorous statistical approaches to determine experimental variability and significance.

    The concept of functional repeatability suggests that while different research teams might use slightly different experimental approaches, the functional outcomes (PNAG synthesis, biofilm formation) should be consistent when studying properly functioning icaD protein. This approach establishes a more objective framework for evaluating research findings and experimental designs in the study of biofilm formation proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.