Recombinant Staphylococcus aureus Probable CtpA-like serine protease (SA1253)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SA1253; Probable CtpA-like serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-496
Protein Length
full length protein
Species
Staphylococcus aureus (strain N315)
Target Names
SA1253
Target Protein Sequence
MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTTLITAVITVVAYIF INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVDYKKKGKVGVITINKF QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD TEAIQTSNDSLKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN IKTIKIGLSALGYKVDNESTQFDQALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK ANKHDDVLDKLINILK
Uniprot No.

Target Background

Database Links

KEGG: sau:SA1253

Protein Families
Peptidase S41A family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What are the known functions of CtpA-like serine proteases in Staphylococcus aureus?

CtpA-like serine proteases in S. aureus are believed to play several important roles in bacterial physiology and pathogenesis:

  • Protein maturation and processing - These proteases often cleave precursor proteins to their mature, functional forms

  • Stress response - They may participate in degrading misfolded or damaged proteins during environmental stress

  • Virulence factor processing - They potentially activate other virulence-associated proteins through proteolytic cleavage

  • Biofilm formation - Some proteases contribute to the formation and maintenance of bacterial biofilms

  • Immune evasion - Certain proteases degrade host immune components

While the precise function of SA1253 has not been fully characterized, its classification as a CtpA-like protease suggests involvement in these cellular processes. Research using gene knockouts or targeted inhibition would be necessary to confirm its specific roles in S. aureus biology .

How does SA1253 compare to other serine proteases in pathogenic bacteria?

SA1253 shares structural and functional similarities with other bacterial serine proteases, particularly those in the S41 family, though with distinct characteristics:

FeatureSA1253HtrA (S. aureus)ClpP (S. aureus)OmpT (E. coli)
FamilyS41A peptidaseS1 peptidaseS14 peptidaseS1 peptidase
Size496 aa, 55.25 kDa~450 aa, ~48 kDa~200 aa, ~22 kDa~300 aa, ~35 kDa
Catalytic residuesSer-Lys dyad (predicted)Ser-His-Asp triadSer-His-Asp triadSer-His-Asp triad
LocalizationMembrane-associatedMembrane-associatedCytoplasmicOuter membrane
FunctionProtein processing (predicted)Stress response, virulenceProtein degradationVirulence

Unlike many extracellular proteases that directly damage host tissues, CtpA-like proteases typically function in protein processing and maturation rather than as direct virulence factors. This processing function distinguishes them from other classes of bacterial proteases that directly degrade host proteins .

What experimental approaches are most effective for expressing and purifying recombinant SA1253?

For optimal expression and purification of recombinant SA1253, the following methodological approach is recommended:

  • Expression system selection: E. coli BL21(DE3) typically provides high yield for bacterial proteins. Consider using the pET expression system with a C-terminal 6xHis tag to facilitate purification while avoiding interference with the N-terminal signal sequence.

  • Optimization protocol:

    • Transform the expression construct into the selected E. coli strain

    • Optimize expression conditions: test IPTG concentrations (0.1-1.0 mM), temperatures (16°C, 25°C, 37°C), and induction times (3h, 6h, overnight)

    • For membrane-associated proteins like SA1253, lower induction temperatures (16-25°C) often improve proper folding

    • Include protease inhibitors during cell lysis to prevent degradation

  • Purification strategy:

    • Initial capture: Ni-NTA affinity chromatography with imidazole gradient elution

    • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

    • Polishing step: Size exclusion chromatography

    • Buffer optimization: Test stability in different pH ranges (6.5-8.5) and salt concentrations

  • Quality assessment:

    • SDS-PAGE for purity evaluation

    • Western blot for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Activity assay using synthetic peptide substrates to confirm functionality

This methodological approach addresses common challenges in recombinant expression of potentially membrane-associated proteases and provides necessary quality control measures .

How can researchers effectively study the enzymatic activity of SA1253?

Studying the enzymatic activity of SA1253 requires specialized approaches:

  • Substrate identification:

    • Utilize peptide libraries to screen for preferred cleavage sites

    • Test known substrates of other CtpA-like proteases

    • Employ proteomics approaches (LC-MS/MS) to identify physiological substrates in S. aureus

  • Kinetic characterization:

    • Develop a FRET-based (Fluorescence Resonance Energy Transfer) assay using synthetic peptides containing identified cleavage sites

    • Determine kinetic parameters (Km, kcat, kcat/Km) under varying conditions (pH, temperature, ionic strength)

    • Assess effects of potential cofactors (divalent cations, particularly Ca²⁺ and Zn²⁺)

  • Inhibitor studies:

    • Screen classic serine protease inhibitors (PMSF, AEBSF, aprotinin) to confirm the catalytic mechanism

    • Develop specific inhibitors based on substrate preference

    • Test the effects of physiologically relevant inhibitors to understand regulation

  • Structure-function analysis:

    • Generate site-directed mutants of predicted catalytic residues

    • Perform comparative activity assays between wild-type and mutant proteins

    • Correlate structural features with catalytic efficiency

This systematic approach allows researchers to comprehensively characterize the enzymatic properties of SA1253, providing insights into its biological function and potential as a therapeutic target .

What is the role of SA1253 in Staphylococcus aureus pathogenesis?

The role of SA1253 in S. aureus pathogenesis remains to be fully elucidated, but several experimental approaches can address this question:

  • Genetic approaches:

    • Generate SA1253 knockout mutants in relevant S. aureus strains

    • Conduct complementation studies to confirm phenotypes

    • Create catalytically inactive mutants to distinguish between enzymatic and structural roles

  • Infection models:

    • Compare virulence of wild-type and SA1253-deficient strains in appropriate animal models

    • Assess bacterial burden, dissemination, and host survival

    • Examine pathological differences in infected tissues

  • Host-pathogen interaction studies:

    • Investigate effects on host immune response genes and proteins

    • Assess impact on neutrophil recruitment and function

    • Determine if SA1253 processes specific virulence factors

Current research suggests that CtpA-like proteases may contribute to pathogenesis through:

  • Processing of cell wall proteins involved in adhesion

  • Maturation of toxins and other virulence factors

  • Stress response during host-imposed stress (oxidative, pH, antimicrobial peptides)

  • Biofilm formation and maintenance

Understanding SA1253's role in pathogenesis could identify it as a potential therapeutic target for anti-virulence strategies against S. aureus infections, particularly antibiotic-resistant strains .

What are the best approaches for studying SA1253 interaction with other bacterial proteins?

To effectively study SA1253's interactions with other bacterial proteins, researchers should employ a multi-faceted approach:

  • Protein-protein interaction screening:

    • Bacterial two-hybrid system: Particularly useful for membrane-associated proteins like SA1253

    • Pull-down assays: Using purified His-tagged SA1253 as bait and S. aureus lysates as prey

    • Co-immunoprecipitation: With antibodies specific to SA1253 or potential interacting partners

    • Surface plasmon resonance (SPR): For quantitative binding analysis of identified candidates

  • Interaction validation:

    • Biolayer interferometry to determine binding kinetics

    • Microscale thermophoresis for analysis of interactions in solution

    • Far-Western blotting to confirm direct protein-protein interactions

    • FRET-based assays for monitoring interactions in real-time

  • Functional analysis of interactions:

    • Co-expression studies to assess effects on protein processing

    • Competition assays with synthetic peptides to map interaction sites

    • In vitro reconstitution of protein complexes to determine functional consequences

    • Crosslinking mass spectrometry to identify interaction interfaces

  • Computational approaches:

    • Molecular docking to predict interaction sites

    • Protein-protein interface analysis based on homologous complexes

    • Coevolution analysis to identify potentially interacting residues

These methodological approaches, particularly when used in combination, provide robust evidence for protein-protein interactions and their functional significance in bacterial physiology and virulence .

How can researchers analyze the structural features of SA1253?

Structural analysis of SA1253 requires a comprehensive approach combining computational and experimental techniques:

What techniques are most effective for studying SA1253 gene regulation in Staphylococcus aureus?

Understanding the regulation of SA1253 expression requires multiple complementary approaches:

  • Transcriptional regulation analysis:

    • Promoter mapping using 5' RACE (Rapid Amplification of cDNA Ends)

    • Reporter gene assays (e.g., promoter-lacZ fusions) to quantify expression

    • Electrophoretic mobility shift assays (EMSA) to identify transcription factor binding

    • ChIP-seq to identify regulatory protein binding sites genome-wide

    • RNA-seq under various conditions to identify expression patterns

  • Environmental and stress response:

    ConditionMethodExpected Outcome
    Antibiotic exposureqRT-PCRDetermine if SA1253 is part of stress response
    Oxygen limitationReporter assaysAssess anaerobic regulation
    Nutrient limitationProteomicsMeasure protein levels during starvation
    Temperature shiftsRNA-seqIdentify temperature-dependent expression
    Host factorsIn vivo expressionDetermine expression during infection
  • Post-transcriptional regulation:

    • Northern blotting to assess mRNA stability

    • Ribosome profiling to measure translation efficiency

    • Analysis of potential regulatory RNAs (sRNAs) affecting SA1253 expression

    • Assessment of RNA secondary structures influencing expression

  • Genetic approaches:

    • Deletion/mutation of potential regulatory elements

    • Overexpression of suspected regulatory proteins

    • CRISPR interference (CRISPRi) to evaluate regulatory networks

These methodologies provide a comprehensive understanding of how SA1253 expression is controlled in response to environmental signals, which may inform when and where this protease functions during colonization and infection .

What is the potential of SA1253 as a target for novel antimicrobial strategies?

SA1253, as a CtpA-like serine protease, represents a promising antimicrobial target for several reasons:

  • Target validation rationale:

    • Essential bacterial processes often involve proteases for protein maturation and turnover

    • Proteases involved in stress response are particularly valuable targets as they help bacteria survive host defenses

    • CtpA-like proteases often process proteins crucial for cell wall maintenance and virulence

  • Inhibitor development approaches:

    • Structure-based design using homology models or experimental structures

    • High-throughput screening of chemical libraries against purified SA1253

    • Fragment-based drug discovery to identify initial binding scaffolds

    • Peptide-based inhibitors designed from substrate recognition sequences

    • Covalent inhibitors targeting the catalytic serine residue

  • Potential advantages as antimicrobial target:

    • Novel target not addressed by current antibiotics, reducing cross-resistance

    • Potential for narrow-spectrum activity specific to S. aureus

    • Anti-virulence approach may reduce selective pressure for resistance

    • Could be effective against metabolically inactive bacterial populations (persisters)

  • Challenges and limitations:

    • Need for selective inhibition to avoid off-target effects on human proteases

    • Potential redundancy in bacterial proteolytic systems

    • Delivery challenges for inhibitors to reach intracellular targets

    • Demonstrating efficacy in appropriate animal models

The development of SA1253 inhibitors could provide novel therapeutic options for combating S. aureus infections, particularly antibiotic-resistant strains like MRSA that represent a significant clinical challenge .

How does SA1253 contribute to antibiotic resistance mechanisms in Staphylococcus aureus?

While direct evidence for SA1253's role in antibiotic resistance is limited, several potential mechanisms warrant investigation:

  • Cell wall remodeling:

    • CtpA-like proteases may process enzymes involved in peptidoglycan synthesis or modification

    • Altered cell wall composition can affect antibiotic penetration and binding

    • Processing of penicillin-binding proteins might influence β-lactam susceptibility

  • Stress response coordination:

    • Proteases often regulate stress response proteins through controlled degradation

    • SA1253 may help coordinate responses to antibiotic exposure

    • Potential role in transitioning cells to antibiotic-tolerant persister state

  • Biofilm contribution:

    • If SA1253 participates in biofilm formation or maintenance, it could indirectly promote antibiotic tolerance

    • Biofilms represent a major mechanism of antibiotic evasion in S. aureus infections

    • Proteolytic processing of matrix proteins may alter biofilm architecture and antibiotic penetration

  • Experimental approaches to investigate:

    • Compare minimum inhibitory concentrations (MICs) between wild-type and SA1253 mutants

    • Assess frequency of resistance development in the presence/absence of SA1253

    • Evaluate biofilm formation and antibiotic tolerance in isogenic strains

    • Perform transcriptomic and proteomic analyses following antibiotic exposure

Understanding SA1253's potential contributions to antibiotic resistance could inform combination therapeutic strategies and help address the growing challenge of resistant S. aureus infections in clinical settings .

What are the immunological implications of SA1253 in host-pathogen interactions?

The interaction between SA1253 and the host immune system represents an important area of research:

  • Potential interactions with host immune components:

    • Processing of bacterial surface proteins to evade immune recognition

    • Modification of pathogen-associated molecular patterns (PAMPs)

    • Potential direct cleavage of host immune factors (complement, antibodies, antimicrobial peptides)

    • Role in processing bacterial toxins that modulate immune response

  • Experimental approaches to investigate immune interactions:

    • Compare wild-type and SA1253-deficient strains in immune cell co-culture models

    • Assess neutrophil recruitment, phagocytosis, and killing efficiency

    • Measure cytokine/chemokine responses in infection models

    • Evaluate complement activation and antibody effectiveness

    • Test susceptibility to antimicrobial peptides

  • Potential as vaccine target:

    • Assessment of SA1253 conservation across S. aureus clinical isolates

    • Determination of surface exposure and accessibility to antibodies

    • Evaluation of protective immunity in animal models

    • Analysis of human antibody responses in S. aureus carriers vs. non-carriers

  • Diagnostic applications:

    • Development of serological assays based on anti-SA1253 antibodies

    • Potential biomarker for specific S. aureus infections or colonization states

Understanding the immunological implications of SA1253 not only provides insights into S. aureus pathogenesis but may also inform vaccine development and diagnostic approaches for S. aureus infections, which remain a significant clinical challenge despite numerous vaccine attempts .

What emerging technologies might advance our understanding of SA1253 function?

Several cutting-edge technologies show promise for elucidating SA1253 function:

  • CRISPR-Cas9 genome editing:

    • Precise modification of SA1253 in its native genomic context

    • Creation of conditional knockouts to study essential functions

    • Introduction of point mutations to assess specific residue functions

    • Genome-wide screens to identify genetic interactions

  • Advanced structural biology approaches:

    • Cryo-electron tomography to visualize SA1253 in its native cellular context

    • Integrative structural biology combining multiple experimental datasets

    • Time-resolved structural studies to capture enzymatic intermediates

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in SA1253 expression

    • Single-cell proteomics to correlate protein levels with phenotypes

    • Microfluidic approaches to study SA1253 function in individual bacteria

    • Live-cell imaging of fluorescently tagged SA1253 to monitor localization and dynamics

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position SA1253 within bacterial regulatory networks

    • Machine learning to predict functional interactions and phenotypic consequences

    • Mathematical modeling of proteolytic networks

These emerging technologies promise to provide unprecedented insights into SA1253 function at molecular, cellular, and population levels, potentially revealing new therapeutic opportunities .

How might comparative genomics inform our understanding of SA1253 evolution and function?

Comparative genomic approaches provide valuable perspectives on SA1253 evolution and functional conservation:

  • Evolutionary analysis framework:

    • Phylogenetic analysis of SA1253 homologs across bacterial species

    • Identification of highly conserved regions suggesting functional importance

    • Detection of positive selection signatures indicating adaptive evolution

    • Assessment of horizontal gene transfer events in the evolutionary history

  • Comparative analysis across S. aureus strains:

    • Examination of SA1253 sequence conservation in clinical vs. commensal isolates

    • Correlation of sequence variations with strain virulence or host specificity

    • Identification of lineage-specific features that might influence function

    • Assessment of genomic context and operon structure across strains

  • Structure-function relationships:

    • Mapping of conserved residues onto predicted structural models

    • Identification of co-evolving residues suggesting functional interactions

    • Comparison with homologous proteases of known function

    • Prediction of substrate specificity based on binding pocket conservation

  • Methodological approach:

    • Whole-genome sequencing of diverse S. aureus isolates

    • Targeted amplification and sequencing of SA1253 from clinical samples

    • Bioinformatic pipeline for identifying sequence variants and structural predictions

    • Statistical analysis of associations between sequence features and phenotypes

This comparative approach provides an evolutionary context for understanding SA1253 function and may identify strain-specific variations with potential clinical significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.